The URL can be used to link to this page

Home My WebLink About2017-10-16 (Regular) Meeting Agenda Packet Please note: If you have a disability and need auxiliary aids or services, please notify the City of Englewood (303-762-2405) at least 48 hours in advance of when services are needed. 1000 Englewood Pkwy – Council Chambers Englewood, CO 80110 AGENDA City Council Regular Meeting Monday, October 16, 2017 ♦ 7:00 PM 1. Call to Order 2. Invocation 3. Pledge of Allegiance 4. Roll Call 5. Consideration of Minutes of Previous Session a. Minutes from the Regular City Council Meeting of October 2, 2017. City Council Regular - 02 Oct 2017 - Minutes - Pdf 6. Recognition of Scheduled Public Comment The deadline to sign up to speak for Scheduled Public Comment is Wednesday, prior to the meeting, through the City Manager’s Office. Only those who meet the deadline can speak in this section. (This is an opportunity for the public to address City Council. There is an expectation that the presentation will be conducted in a respectful manner. Council may ask questions for clarification, but there will not be any dialogue. Please limit your presentation to five minutes.) a. Colin Waters from the Colorado Lottery will officially present the Starburst Award to the City of Englewood. b. Kathleen Bailey, an Englewood resident, will address Council regarding health and safety. c. Patrick Fitzgerald will address Council regarding Wastewater Treatment Plant biogas. d. Carolyn Moershel, an Englewood resident, will address Council regarding ADU's/short term rentals. e. Elaine Hults, an Englewood resident, will address Council. 7. Recognition of Unscheduled Public Comment Speakers must sign up for Unscheduled Public Comment at the beginning of the meeting. (This is an opportunity for the public to address City Council. There is an expectation that the presentation will be conducted in a respectful manner. Council may ask questions for clarification, but there will not be any dialogue. Please limit your presentation to three minutes. Time for unscheduled public comment may be limited to 45 minutes, and if limited, shall be continued to General Discussion.) Council Response to Public Comment. 8. Communications, Proclamations, and Appointments 9. Consent Agenda Items Page 1 of 319 Englewood City Council Regular Agenda October 16, 2017 Please note: If you have a disability and need auxiliary aids or se rvices, please notify the City of Englewood (303-762-2405) at least 48 hours in advance of when services are needed. a. Approval of Ordinances on First Reading i. Romans Park Permanent Easement Council Bill 65 The Parks, Recreation and Library Services Department recommends that Council approve a Bill for an Ordinance for a permanent easement at Romans Park for the Public Service Company of Colorado's relocation of an electrical enclosure. Staff: Open Space Manager Dave Lee b. Approval of Ordinances on Second Reading. c. Resolutions and Motions i. 2018 Community Development Block Grant (CDBG) Application CDBG Staff recommends that Council approve a Resolution authorizing staff to apply to Arapahoe County for the City of Englewood’s portion of federal fiscal year 2018 Community Development Block Grant (CDBG) funds. Staff: Senior Planner Harold Stitt 10. Public Hearing Items 11. Ordinances, Resolutions and Motions a. Approval of Ordinances on First Reading i. Planned Unit Development - 3333, 3323, 3317 South Pearl Street Council Bill 66 South Pearl Street Planned Unit Development Staff recommends Council approve a Bill for an Ordinance approving 3333, 3323, 3317 South Pearl Street Planned Unit Development. Staff: Planner II Audra Kirk ii. Amending the Code regarding the Local Licensing Authority for liquor and marijuana Council Bill 67 Staff recommends Council approve a Bill for an Ordinance amending the Englewood Municipal Code 2000 to establish a Hearing Officer as the Englewood Local Liquor and Marijuana Licensing Authority. Staff: Acting City Clerk Stephanie Carlile b. Approval of Ordinances on Second Reading i. 2018 City of Englewood Budget Ordinances Council Bill 53 Staff recommends Council approve the proposed ordinance adopting the 2018 Budget. Staff: Finance and Administrative Services Director Kathleen Rinkel ii. 2018 City of Englewood Budget Appropriations Council Bill 52 Page 2 of 319 Englewood City Council Regular Agenda October 16, 2017 Please note: If you have a disability and need auxiliary aids or se rvices, please notify the City of Englewood (303-762-2405) at least 48 hours in advance of when services are needed. Staff recommends Council approve the proposed ordinance appropriating funds for 2018. Staff: Finance and Administrative Services Director Kathleen Rinkel iii. 2018 LEWWTP Budget Ordinances Council Bill 56 Staff recommends Council approve the proposed ordinance adopting the Littleton/Englewood Wastewater Treatment Plant Budget for fiscal year 2018. Staff: Finance and Administrative Services Director Kathleen Rinkel iv. 2018 LEWWTP Budget Appropriation Council Bill 54 Staff recommends Council approve the proposed ordinance appropriating funds for the Littleton/Englewood Wastewater Treatment Plan for fiscal year 2018. Staff: Finance and Administrative Services Director Kathleen Rinkel v. Establish 2017 Mill Levy (Collected in 2018) Council Bill 55 Staff recommends that Council approve an ordinance establishing the 2017 mill levy to be collected in 2018. Staff: Finance and Administrative Services Director Kathleen Rinkel c. Resolutions and Motions i. Belleview Park Improvement Project Belleview Park Improvement Project - Pdf The Parks, Recreation and Library Services Department recommends that Council approve, by motion, the contract for construction with Construction Concepts, Inc. for the Belleview Park Improvement Project. Staff: Open Space Manager Dave Lee ii. L/E WWTP Strategic Operating Plan (SOP) L/E WWTP Strategic Operating Plan (SOP) - Pdf The Littleton / Englewood Wastewater Treatment Plant (L/E WWTP) Supervisory Committee and staff recommend that City Council approve, by motion, a professional services agreement with Carollo Engineers, Inc. to conduct the L/E WWTP Strategic Operations Plan in the amount of $500,000. Staff: Littleton/Englewood Wastewater Treatment Plant Director John Kuosman iii. L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project - Pdf The Littleton / Englewood Wastewater Treatment Plant (L/E WWTP) Supervisory Committee and staff recommend that City Council approve, by motion, a professional services agreement with Carollo Engineers, Inc. to conduct the design engineering and contractor procurement services for the L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project in the amount of $380,400. Staff: Littleton/Englewood Wastewater Treatment Plant Director John Kuosman 12. General Discussion Page 3 of 319 Englewood City Council Regular Agenda October 16, 2017 Please note: If you have a disability and need auxiliary aids or se rvices, please notify the City of Englewood (303-762-2405) at least 48 hours in advance of when services are needed. a. Mayor's Choice b. Council Members' Choice 13. City Manager’s Report a. Agenda setting. 14. City Attorney’s Report 15. Adjournment Page 4 of 319 MINUTES City Council Regular Meeting Monday, October 2, 2017 1000 Englewood Pkwy – Council Chambers 7:00 PM 1 Call to Order The regular meeting of the Englewood City Council was called to order by Mayor Jefferson at 7:02 p.m. A moment of silence was held for all of the victims of the Las Vegas shooting. 2 Invocation The invocation was given by Council Member Russell. 3 Pledge of Allegiance The Pledge of Allegiance was led by Council Member Russell. 4 Roll Call COUNCIL PRESENT: Mayor Joe Jefferson Mayor Pro Tem Rick Gillit Council Member Laurett Barrentine Council Member Amy Martinez Council Member Linda Olson Council Member Rita Russell Council Member Steve Yates A quorum was present. COUNCIL ABSENT: None STAFF PRESENT: City Manager Keck City Attorney McKenney Brown Assistant City Manager Woulf City Clerk Ellis Executive Assistant Fenton, Community Development Director Rinkel, Finance and Administrative Services Director Henderson, Public Works Engineering Manager Weller, Public Works Budget and Revenue Manager Nolan, Finance and Administrative Services Page 1 of 11 Draft Page 5 of 319 City Council Regular October 2, 2017 Network Engineer Siegrist, Information Technology Deputy Police Chief Watson, Police Department Technical Support Specialist Munnell, Information Technology 5 Consideration of Minutes of Previous Session a) Minutes from the Regular City Council Meeting of September 18, 2017. Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates TO APPROVE THE MINUTES OF THE REGULAR CITY COUNCIL MEETING OF SEPTEMBER 18, 2017. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 7 0 0 Motion CARRIED. 6 Recognition of Scheduled Public Comment a) Ben Watson, an Englewood resident, was scheduled to address Council regarding cell phone tower implications but was not present. b) Kathleen Bailey, an Englewood resident, addressed Council regarding health and safety. c) Belinda Porter, an Englewood resident, addressed Council regarding ethics. d) Elaine Hults, an Englewood resident, was scheduled to address Council but was not present. e) Geoff Frazier, an Englewood resident, addressed Council regarding biogas. 7 Recognition of Unscheduled Public Comment a) Carolyn Moershel addressed Council regarding accessory dwelling units. b) Doug Cohn, an Englewood resident, addressed Council regarding history. c) Ida May Nicholl, an Englewood resident, addressed Council regarding history. Council responded to Public Comment. 8 Communications, Proclamations, and Appointments Page 2 of 11 Draft Page 6 of 319 City Council Regular October 2, 2017 a) Double Tenth Day of the Republic of China (Taiwan) Moved by Council Member Rita Russell Seconded by Council Member Amy Martinez TO APPROVE A PROCLAMATION DECLARING OCTOBER 10, 2017 AS DOUBLE TENTH DAY OF THE REPUBLIC OF CHINA (TAIWAN) OR TAIWAN FRIENDSHIP DAY. For Against Abstained Amy Martinez (Seconded By) x Joe Jefferson x Linda Olson x Laurett Barrentine x Rita Russell (Moved By) x Rick Gillit x Steve Yates x 7 0 0 Motion CARRIED. 9 Consent Agenda Items a) Approval of Ordinances on First Reading There were no additional items submitted for approval on first reading. (See Agenda Item 11 (a) (i - v).) b) Approval of Ordinances on Second Reading. i) L/E WWTP Revised Cherry Hills Village Sanitation District Addendum to Connector's Agreement ORDINANCE NO. 53 (COUNCIL BILL NO. 57 INTRODUCED BY COUNCIL MEMBER GILLIT) AN ORDINANCE AUTHORIZING A REVISED INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN CHERRY HILLS VILLAGE SANITATION DISTRICT AND THE CITY OF ENGLEWOOD, COLORADO. ii) L/E WWTP Revised South Arapahoe Sanitation District Addendum to Connector's Agreement ORDINANCE NO. 54 (COUNCIL BILL NO. 58 INTRODUCED BY COUNCIL MEMBER GILLIT) Page 3 of 11 Draft Page 7 of 319 City Council Regular October 2, 2017 AN ORDINANCE AUTHORIZING A REVISED INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN SOUTH ARAPAHOE SANITATION DISTRICT AND THE CITY OF ENGLEWOOD, COLORADO. iii) L/E WWTP Cherryvale Sanitation District Addendum to Connector's Agreement ORDINANCE NO. 55 (COUNCIL BILL NO. 59 INTRODUCED BY COUNCIL MEMBER GILLIT) AN ORDINANCE AUTHORIZING AN INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN CHERRYVALE SANITATION DISTRICT AND THE CITY OF ENGLEWOOD, COLORADO. iv) L/E WWTP Revised City of Sheridan Addendum to Connector's Agreement ORDINANCE NO. 56 (COUNCIL BILL NO. 60 INTRODUCED BY COUNCIL MEMBER GILLIT) A BILL FOR AN ORDINANCE AUTHORIZING A REVISED INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN THE CITY OF SHERIDAN AND THE CITY OF ENGLEWOOD, COLORADO. v) L/E WWTP Revised Southgate Sanitation District Addendum to Connector's Agreement ORDINANCE NO. 57 (COUNCIL BILL NO. 61 INTRODUCED BY COUNCIL MEMBER GILLIT) AN ORDINANCE AUTHORIZING A REVISED INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN SOUTHGATE SANITATION DISTRICT AND THE CITY OF ENGLEWOOD, COLORADO. vi) L/E WWTP Sheridan Sanitation District No. 1 Addendum to Connector's Agreement ORDINANCE NO. 58 (COUNCIL BILL NO. 62 INTRODUCED BY COUNCIL MEMBER GILLIT) A BILL FOR AN ORDINANCE AUTHORIZING AN INTERGOVERNMENTAL ADDENDUM TO WASTEWATER CONNECTOR’S AGREEMENT FOR DISTRICTS BETWEEN SHERIDAN SANITATION DISTRICT #1 AND THE CITY OF ENGLEWOOD, Page 4 of 11 Draft Page 8 of 319 City Council Regular October 2, 2017 COLORADO. Moved by Council Member Rick Gillit Seconded by Council Member Linda Olson MOTION TO APPROVE CONSENT AGENDA ITEMS 9 (b) (i - vi). For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson (Seconded By) x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates x 7 0 0 Motion CARRIED. c) Resolutions and Motions There were no additional Resolutions or Motions (See Agenda Item 11 (c) (i)- (iv).) 10 Public Hearing Items No public hearing was scheduled before Council. 11 Ordinances, Resolutions and Motions a) Approval of Ordinances on First Reading i) 2018 City of Englewood Budget Ordinances Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates COUNCIL BILL NO. 53 INTRODUCED BY COUNCIL MEMBER GILLIT A BILL FOR AN ORDINANCE ADOPTING THE BUDGET OF THE CITY OF ENGLEWOOD, COLORADO, FOR FISCAL YEAR 2018. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson x Page 5 of 11 Draft Page 9 of 319 City Council Regular October 2, 2017 Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 5 2 0 Motion CARRIED. ii) 2018 City of Englewood Budget Appropriations Moved by Council Member Rick Gillit Seconded by Council Member Linda Olson COUNCIL BILL NO. 52 INTRODUCED BY COUNCIL MEMBER GILLIT A BILL FOR AN ORDINANCE APPROPRIATING MONIES FOR ALL MUNICIPAL PURPOSES IN THE CITY OF ENGLEWOOD, COLORADO, FOR FISCAL YEAR BEGINNING JANUARY 1, 2018, AND ENDING DECEMBER 31, 2018, CONSTITUTING WHAT IS TERMED THE ANNUAL APPROPRIATION BILL FOR FISCAL YEAR 2018. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson (Seconded By) x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates x 5 2 0 Motion CARRIED. iii) 2018 LEWWTP Budget Ordinances Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates COUNCIL BILL NO. 56 INTRODUCED BY COUNCIL MEMBER GILLIT A BILL FOR AN ORDINANCE ADOPTING THE BUDGET FOR THE LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT FOR FISCAL YEAR 2018. For Against Abstained Amy Martinez x Joe Jefferson x Page 6 of 11 Draft Page 10 of 319 City Council Regular October 2, 2017 Linda Olson x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 5 2 0 Motion CARRIED. iv) 2018 LEWWTP Budget Appropriation Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates COUNCIL BILL NO. 54 INTRODUCED BY COUNCIL MEMBER GILLIT A BILL FOR AN ORDINANCE APPROPRIATING MONIES FOR THE LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT PURPOSES IN THE FISCAL YEAR BEGINNING JANUARY 1, 2018, AND ENDING DECEMBER 31, 2018, CONSTITUTING WHAT IS TERMED THE ANNUAL APPROPRIATION BILL FOR FISCAL YEAR 2018. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 5 2 0 Motion CARRIED. v) Establish 2017 Mill Levy (Collected in 2018) - 1st Reading Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates COUNCIL BILL NO. 55 INTRODUCED BY COUNCIL MEMBER GILLIT A BILL FOR AN ORDINANCE FIXING THE TAX LEVY IN MILLS UPON EACH DOLLAR OF THE ASSESSED VALUATION OF ALL TAXABLE PROPERTY WITHIN THE CITY OF ENGLEWOOD, COLORADO. For Against Abstained Page 7 of 11 Draft Page 11 of 319 City Council Regular October 2, 2017 Amy Martinez x Joe Jefferson x Linda Olson x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 7 0 0 Motion CARRIED. b) Approval of Ordinances on Second Reading There were no additional Ordinances on Second Reading. (See agenda items 9 (b) (i-vi).) c) Resolutions and Motions i) Police Headquarters Building Commissioning Moved by Council Member Rita Russell Seconded by Council Member Laurett Barrentine MOTION TO TABLE TO THE NEXT REGULAR COUNCIL MEETING. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson x Laurett Barrentine (Seconded By) x Rita Russell (Moved By) x Rick Gillit x Steve Yates x 2 5 0 Motion DEFEATED. Moved by Council Member Rick Gillit Seconded by Council Member Linda Olson MOTION APPROVING A CONTRACT WITH NORESCO, FOR BUILDING COMMISSIONING SERVICES FOR THE POLICE HEADQUARTERS PROJECT, IN THE AMOUNT OF $43,325.00. For Against Abstained Page 8 of 11 Draft Page 12 of 319 City Council Regular October 2, 2017 Amy Martinez x Joe Jefferson x Linda Olson (Seconded By) x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates x 5 2 0 Motion CARRIED. ii) Technology Consulting Services for Police Headquarters Building Moved by Council Member Rick Gillit Seconded by Council Member Steve Yates MOTION APPROVING A CONTRACT WITH ACUITY, INC., FOR IT AND AV DESIGN CONSULTING SERVICES FOR THE POLICE HEADQUARTERS PROJECT, IN THE AMOUNT OF $27,150.00. For Against Abstained Amy Martinez x Joe Jefferson x Linda Olson x Laurett Barrentine x Rita Russell x Rick Gillit (Moved By) x Steve Yates (Seconded By) x 7 0 0 Motion CARRIED. iii) Dry Gulch Floodplain Resolution Moved by Council Member Rick Gillit Seconded by Council Member Linda Olson MOTION TO APPROVE A RESOLUTION ACKNOWLEDGING THE SUBMISSION OF THE HARVARD GULCH AND DRY GULCH FLOOD HAZARD AREA DELINIATION REPORT TO THE COLORADO WATER CONSERVATION BOARD. Moved by Council Member Rita Russell Seconded by Council Member Linda Olson MOTION TO TABLE THIS AGENDA ITEM TO THE FIRST COUNCIL MEETING IN NOVEMBER (11/6/17). Page 9 of 11 Draft Page 13 of 319 City Council Regular October 2, 2017 For Against Abstained Linda Olson (Seconded By) x Rita Russell (Moved By) x Amy Martinez x Joe Jefferson x Laurett Barrentine x Rick Gillit x Steve Yates x 7 0 0 Motion CARRIED. TABLED UNTIL 11/6/17 iv) Memorandum of Understanding (MOU) with Town of Morrison THIS AGENDA ITEM WAS PULLED. 12 General Discussion a) Mayor's Choice i) Joshua School Historic Preservation Grant application. No action taken, City Manager Keck just informed Council about the grant. b) Council Members' Choice 13 City Manager’s Report a) City Manager Keck advised Council about the Xcel Energy Renewable Connect Program. b) City Manager Keck discussed the Budget Advisory Committee feedback report on the Budget. The committee is scheduled to meet with Council on December 11, 2017. 14 City Attorney’s Report City Attorney McKenney Brown announced the City Attorney's office will be closed on Friday. The City Attorney staff will be attending a CML continuing education course. 15 Adjournment MAYOR JEFFERSON MOVED TO ADJOURN. The meeting adjourned at 10:02 p.m. 16 Mayor/Manager Agenda Setting Page 10 of 11 Draft Page 14 of 319 City Council Regular October 2, 2017 City Manager Keck and Mayor Jefferson discussed upcoming agenda items. Mayor Jefferson felt this discussion should have been posted as a separate meeting. This discussion adjourned at 10:10 p.m. Acting City Clerk Page 11 of 11 Draft Page 15 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Dave Lee DEPARTMENT: Parks, Recreation & Library DATE: October 16, 2017 SUBJECT: Romans Park Permanent Easement DESCRIPTION: Romans Park Permanent Easement RECOMMENDATION: The Parks, Recreation and Library Services Department recommends that Council approve a permanent easement at Romans Park for the Public Service Company of Colorado's relocation of an electrical enclosure. PREVIOUS COUNCIL ACTION: Council previously approved Ordinance No. 25, Series of 1999, to Public Service Company of Colorado authorizing a grant of easement for underground electrical lines at Romans Park. SUMMARY: Public Service Company seeks to relocate one existing electrical enclosure located in Romans Park outside the current easement in order to safely access and maintain the utility. This will not have a negative impact on pedestrian access of users of the park. ANALYSIS: Public Service wishes to provide better safety to their staff and improve their responsiveness for repairs to their infrastructure. FINANCIAL IMPLICATIONS: There are no financial implications with this easement. ALTERNATIVES: There are no alternatives identified. ATTACHMENTS: Public Service Company of Colorado Easement Council Bill 65 Exhibit A Romans Park Area Map Page 16 of 319 -1- BY AUTHORITY ORDINANCE NO. COUNCIL BILL NO. 65 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER _________________ A BILL FOR AN ORDINANCE AUTHORIZING A GRANT OF A SWITCH BOX UTILITY EASEMENT BETWEEN THE CITY OF ENGLEWOOD, COLORADO AND PUBLIC SERVICE COMPANY OF COLORADO, LOCATED IN ROMANS PARK. WHEREAS, in 1999, the Public Service Company installed electrical lines and switching boxes in Romans Park located at 1700 East Floyd Avenue to service upgraded electrical lines; and WHEREAS, the current utility switch boxes are being upgraded and one will be moved to accommodate access to both boxes; and WHEREAS, with the passage of this Ordinance a utility easement that is 15 feet by 17 feet is hereby granted to Public Service Company, for the relocation of an existing switch box in Romans Park; NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, AS FOLLOWS: Section 1. The Grant this utility easement to Public Service Company of Colorado, by the City of Englewood, Colorado, attached hereto as Exhibit A, is hereby accepted and approved by the Englewood City Council. Section 2. The Mayor is authorized to execute and the City Clerk to attest and seal the “Public Service Company of Colorado Switch Box Utility Easement” for and on behalf of the City of Englewood, Colorado. Introduced, read in full, and passed on first reading on the 16th day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 19th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 18th day of October 2017. Page 17 of 319 -2- Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile Acting, City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Bill for Ordinance introduced, read in full, and passed on first reading on the 16th day of October, 2017. Stephanie Carlile Page 18 of 319 Page 19 of 319 mamaA9.M mx:_m_4 >I mo_<_>zw _u>_~_A _.mm2_>zmz4 m>mm_smzq -_.>xom_.> >um_.om_2_m:a_<_:n53mmoczamm.ozmbcmnmq amte S mango:8.._.o<<:m::uAmoE_._.mmzmmmm<<mmr23m 9:_u...:o_um__<_m~§m:.02522>Sum:om.maa2.oo_oaao._<_:mS moamzm_um%$333 mm_"o__o<<m” wmmiaamo::6moi:__:m23m.m89Sam_umoommmmamaammozcmqS mmnmuzo:zcaumq >888?>_.mum:om 0952xmooam:63<<_.=O_..Emaonzim?ooamq oq Em mocz.o:m-:m:2 2:...moc5mwm~o_._m-ncm:m_1Ami»mmiv o« 33mmomo:8Emmaz8.8.8_<<.w8.8Ems Smzomm$.$.?=m‘mar98$3.m_o_..mSm mocz._.:m 9.$3 a moo.2.8 vmoommmmamzr8=6 mo?smmm?0039.Emqmon Smaowm$.$_S_.m.m.8?mmn =._m:ommoo.oo.om..<<.3.8«max 25:8zmo.mm.m._..<<.3.8$3 Emsomz8.8.8_.m.3.8«mm...8=5_uo_:~2 mmmiazm. _um_.om_>noamiwmmmmncmqm«mm»:53o_._mmm. >mmrossmagammoacmao:mxzz,>.mzmm.N2Mmzmozma388 man3%mcm:zmamon .26mc?oq2in%..§__aa=_m2.03» _.. 9&8.»Pm mmmom.Emum?mn.on am_..m_..2 mm...__..o..395 <<mm.089. 0:5.9:61.rmxwsooa.00momma.on>:m:m.mm.83.552 Low zo.2o~3.§.o_8.._ucc__owm_.<8m oo3um:< 3oo_oaao.mana:28cmnonmacmammau?wmmazzmm302.2538 _m:a m:2m<. _<_o:$ _..mcqcwox.nrmmmmom 33,Eumooo:.8235omoamam3:3m:2m<6u-aooSm-_2ouomma-ammn=um8m_>.xoamsm3...aonx Sag<<mm»o......,:U_._<m.was_n.rmxmsooa.00 momma mm:_mm:mn:m_ouuo_.E==<man35..ESEmm_.::n.no3 _ mou.mmm.u8o _ wow26 33 Ex Page 20 of 319 Page 21 of 319 Page 22 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Harold Stitt DEPARTMENT: Community Development DATE: October 16, 2017 SUBJECT: 2018 Community Development Block Grant (CDBG) Application DESCRIPTION: 2018 Community Development Block Grant (CDBG) Application RECOMMENDATION: Staff recommends that Council approve a Resolution authorizing staff to apply to Arapahoe County for the City of Englewood’s portion of federal fiscal year 2018 Community Development Block Grant (CDBG) funds. PREVIOUS COUNCIL ACTION: City Council has approved Resolutions to file Community Development Block Grant (CDBG) applications annually since 1977. Participation in the Arapahoe County entitlement program began in 1991. Participation is authorized in three-year increments. Ordinance 19, Series of 2015, approved an Intergovernmental Agreement to participate in the Arapahoe County Community Development Block Grant and HOME Investment Partnership Programs for federal fiscal years 2016 through 2018. ANALYSIS: The U. S. Department of Housing and Urban Development (HUD) CDBG Entitlement Program provides grants to units of local government and urban counties to meet housing and community development needs. The objective of the program is to enhance urban communities by providing: •decent, safe, affordable housing; •improved infrastructure; •public facilities and services; •economic opportunities. The Federal Program objectives are achieved through projects developed by local governments that primarily benefit low and moderate-income families as well as other federal objectives. The request for funds may also include activities that meet urgent development needs in communities such as damage from flooding, tornadoes, fire, etc. Local governments determine which activities best serve the objectives of the program. Page 23 of 319 Funds are appropriated annually by the Congress for the CDBG program and are allocated by statutory formula to each entitlement area. Arapahoe County is approved as an urban county entitlement area. The CDBG grant funds are currently distributed to participating cities within Arapahoe County. Each participating city receives a set-aside portion of the total CDBG allocation. The current participating cities are the Cities of Englewood, Littleton, Sheridan, Glendale, Deer Trail, Centennial, and Greenwood Village. The funding level for the City of Englewood for FY2018 is anticipated to be $135,000. Applications for each proposed project must be submitted to Arapahoe County no later than November 4, 2016 in order to receive 2018 CDBG funding. The applications for the City of Englewood will be for a total of $135,000.00. Englewood’s FY2018 program consists of two projects. These projects continue to meet current housing and neighborhood needs benefitting low and moderate-income families. All projects are subject to additional review by City staff, Arapahoe County CDBG administrators and the County Commissioners. The listed projects and funding levels may change based on those reviews. FY2018 CDBG funds will be requested for the following projects: 1)$115,000 for an energy efficiency home improvement project focusing on improvements that provide increased energy conservation and efficiency in the home; 2)$20,000 for a sixteenth year request to transfer a portion of the City’s CDBG allocation to directly fund the Family Tree application that assists with staffing needs for the House of Hope homeless shelter. Family Tree will submit an application directly to Arapahoe County for the grant. A letter of sponsorship is only required from the City to support Family Tree’s application to Arapahoe County. Attached for Council's information is the blank application form. FINANCIAL IMPLICATIONS: Existing Community Development staff will administer the proposed projects. Staff salaries and benefits represent the City’s participation in the projects. ATTACHMENTS: Resolution Page 24 of 319 RESOLUTION NO. SERIES OF 2017 A RESOLUTION AUTHORIZING TH E CITY OF ENGLEWOOD, COLORADO, TO FILE AN APPLICATION WITH ARAPAHOE COUNTY FOR 2018 COMMUNIT Y DEVELOPMENT BLOCK GRANT (CDBG) FUNDS. WHEREAS, the Englewood City Council has approved CDBG applications since 1977 and approved the execution of an Intergovernmental Agreement with the passage of Ordinance No. 37, Series of 1991, covering the City's participation in the Arapahoe County CDBG Entitlement Program for funding years 1992 through 1994; and WHEREAS, the Englewood City Council approved passage of Ordinance No. 13, Series of 2006, authorizing the execution of an Intergovernmental Agreement between the City of Englewood and Arapahoe County covering participation in the Arapahoe County CDBG Entitlement Program for funding years 2007 through 2009; and WHEREAS, the Englewood City Council approved passage of Ordinance No. 22, Series of 2009, authorizing the execution of an Intergovernmental Agreement between the City of Englewood and Arapahoe County covering participation in the Arapahoe County CDBG Program and HOME Investment Partnership Programs for federal fiscal years 2010 through 2012; and WHEREAS, the Englewood City Council approved passage of Ordinance No. 25, Series of 2012, authorizing the execution of an Intergovernmental Agreement between the City of Englewood and Arapahoe County covering participation in the Arapahoe County CDBG Program and HOME Investment Partnership Programs for federal fiscal years 2013 through 2015; and WHEREAS, the Englewood City Council approved passage of Ordinance No. 19, Series of 2015, authorizing the execution of an Intergovernmental Agreement between the City of Englewood and Arapahoe County covering participation in the Arapahoe County CDBG Program and HOME Investment Partnership Programs for federal fiscal years 2016 through 2018; and WHEREAS, the Arapahoe County Community Development Block Grant Program provides grants to participating municipalities to meet housing and community development needs; and WHEREAS, to compete in the Arapahoe County Community Development Block Grant Program, local governments must submit an application; and Page 25 of 319 WHEREAS, the City of Englewood has received a notice of fund availability; and WHEREAS, the City of Englewood, Colorado, desires to apply for these funds through the Arapahoe County 2018 Community Development Block Grant Program to fund the Energy Efficiency Englewood Project and House of Hope staffing project. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. The City of Englewood, Colorado, is hereby authorized to file an application for 2018 Arapahoe County Community Development Block Grant funds. Section 2. The Mayor and City Clerk are authorized to sign and attest all necessary forms, documents, assurances and certifications for the Community Development Block Grant application for and on behalf of the City Council and the City of Englewood. ADOPTED AND APPROVED this 16th day of October, 2017. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk for the City of Englewood, Colorado, hereby certify the above is a true copy of Resolution , Series of 2017. Stephanie Carlile, Acting City Clerk Page 26 of 319 1 Community Resources Department Housing and Community Development Services 1690 W. Littleton Boulevard, Suite 300 Littleton, CO 80120 (303) 738-8062 2018 Community Development Block Grant (CDBG) Application for Funding Applicant: Project: CDBG Request: Page 27 of 319 2 ORGANIZATION Organization: Type: Faith Based Organization: DUNS Number: Tax ID Number: Active SAMS Registration: Mailing Address: City, State, Zip Code: Phone Number: Website: PERSONNEL Chief Official: Title: Phone Number: Email Address: Add to CDBG Mailing List Project Manager: Title: Phone Number: Email Address: Add to CDBG Mailing List PROJECT Project Name: Project Type: Project Address, or Project Service Area: CDBG Funds Requested: Total Project Cost: CDBG Funds as % of Total Project Cost: Summarize Project in One Sentence: Page 28 of 319 3 1. Project meets the following CDBG National Objective: (Only Choose One) ☐ Low and Moderate Income Benefit ☐ Slum or Blight ☐ Catastrophic or Urgent Need 2. Project meets the following secondary CDBG National Objective: (Only Choose One) ☐ Create Suitable Living Environments ☐ Provide Decent Affordable Housing ☐ Create Economic Opportunities 3. Project meets the following CDBG Low to Moderate Income Benefit Categories: (Only Choose One: Area Benefit, Limited Clientele, Housing Rehabilitation, Jobs) ☐ Area Benefit: At least 51% of the residents within the activity area are LMI If selected, please include a map of the project and/or organization’s service area and most recent Census Tract/Block Group data for the proposed area benefit ☐ Limited Clientele: Choose one of the following groups that best describes the persons served ☐ At least 51% of the clientele served are LMI persons Requires Income Eligibility Documentation ☐ The activity has income eligibility requirements limiting the activity exclusively to LM I persons ☐ The activity is of such nature and location that it may be reasonable concluded that the clientele are LMI persons ☐ The activity serves a “presumed benefit” population, including: ☐ Abused Children ☐ Elderly Persons (62 or Older) ☐ Battered Spouses ☐ Severel y Disabled Adults ☐ Illiterate Adults ☐ Persons Living with AIDS/HIV ☐ Migrant Farm Workers ☐ Homeless Persons Page 29 of 319 4 ☐ Housing Rehabilitation: Identify the t ypes of housing units this project will serve ☐ Single-Family ☐ Multi-Family ☐ Owner Occupied ☐ Renter Occupied * Housing units MUST be occupied by LMI persons ☐ Jobs Choose the category that best reflects the project goal: ☐ Job Creation ☐ Job Retention * At least 51% of jobs MUST be filled/retained by LMI persons 4. Project meets one of the following CDBG National Outcomes: ☐ Availability/Accessibility ☐ Affordability ☐ Sustainability 5. Which Priority Need outlined in the Arapahoe County 2014-2018 Consolidated Plan does your project meet? ☐ Housing Needs ☐ Community Development Needs (Non-Housing) ☐ Economic Development ☐ Public Facilities and Infrastructure ☐ Public Services ☐ Homelessness 6. Which Goal outlined in the Arapahoe County 2014-2018 Consolidated Plan does your project meet to address the aforementioned Priority Need? ☐ Preservation of Existing Housing Stock ☐ Expanding and Preserving Homeownership ☐ Public Services ☐ Handicapped Services Page 30 of 319 5 ☐ Senior Services ☐ Youth Services ☐ Public Facility Improvements ☐ Public Infrastructure Improvements ☐ Homeless Prevention Services ☐ Emergency Housing and Shelter for Homeless ☐ Fair Housing 7. Provide a brief narrative on the purpose of this project and how it will address the mission, objectives and priorities of the CDBG program by elaborating on your answers to questions 1-6 above. 8. Provide a brief narrative describing the project goals, measureable outcomes and anticipated community impact, focusing specifically on the target population and clients served, as well as the issue(s) being addressed. For each Measurable Outcome, Please Identif y: a. Outcome Measurement b. Data Source c. Data Collection Methodology Page 31 of 319 6 OUTCOME #1 OUTCOME MEASUREMENT DATA SOURCE DATA COLLECTION METHODOLOGY OUTCOME #2 OUTCOME MEASUREMENT DATA SOURCE DATA COLLECTION METHODOLOGY Page 32 of 319 7 OUTCOME #3 OUTCOME MEASUREMENT DATA SOURCE DATA COLLECTION METHODOLOGY 9. Provide the specific number of Arapahoe County residents served by your organization annually. Page 33 of 319 8 10. Specific to this project only, estimate the number and percentage of Arapahoe County residents that will benefit from this project. * Please identify if beneficiaries will be counted as: ☐ Persons or ☐ Households * Please provide the best estimate for the number of beneficiaries in each municipality: Municipality Number Served Percent of Total Served Aurora Bow Mar, Columbine Valley, Foxfield, Cherry Hills Village Centennial Deer Trail Englewood Glendale Greenwood Village Littleton Sheridan Unincorporated Arapahoe County TOTAL (Excluding Aurora) Page 34 of 319 9 11. Based on the HUD 2017 Income Guidelines, estimate the number and percentage of income-qualified Arapahoe County residents that will benefit from this specific project. Extremely Low 0-30% AMI Low 31-50% AMI Moderate 51-80% AMI Non-LMI > 80% AMI Number Served Percent of Total 12. How many Arapahoe County residents received this service during your last fiscal year? Page 35 of 319 10 13. What is the CDBG cost per client for this specific project? 14. How will CDBG income eligibility be documented and met? Please provide a short narrative, describing how clients certify their eligibility, e.g. proof of residency, monthly or annual income, family size etc… 15. Provide a thorough description of the project parameters, detailing who, what, when, where, why and how this project will address the aforementioned CDBG priorities and goals. Page 36 of 319 11 16. Provide an estimated timeline for completing the project during the 2018 grant year (May 1, 2018 – April 30, 2019), including relevant dates/phases. Project Activity or Phase Month, Year Start of Grant Year May 1, 2018 End of Grant Year April 30, 2019 17. What obstacles could delay the start and/or completion of this project; how will these potential delays be addressed? 18. Is there a minimum amount of CDBG funding needed to make this project feasible and viable given your current funding and commitments? If so, what is the minimum amount of CDBG funds needed to complete this project? Page 37 of 319 19. Provide a detailed project budget (not organizational budget). A B C D E F G H Budget Items Description / Details CDBG Request Other Funds Total Cost Source of Funds Secured Funds Unsecured Funds Administration / Personnel Operations Contract Services Project Delivery TOTAL $ $ $ % OF TOTAL $ $ $ 12 Page 38 of 319 13 20. Please provide information about your agency: a. Background/History b. Mission c. Goals d. Services e. Personnel f. Finances g. Federal Grant Page 39 of 319 14 h. Audits i. CDBG Experience 21. Does your organization currently: ☐ YES ☐ NO Conduct an annual independent financial audit? ☐ YES ☐ NO Have a written policy and procedure for determining client eligibility? ☐ YES ☐ NO Collect and maintain demographic information for each client? ☐ YES ☐ NO Have a written employee conflict of interest policy and procedure? ☐ YES ☐ NO Allocate employee’s salaries and benefits to multiple grants, or funding streams? ☐ YES ☐ NO If not, does your organization have the resources and capacity to allocate and track staff time to specific projects/grants? ☐ YES ☐ NO Have a written procurement/purchasing policy? 22. Please list the names and titles of all persons with the authority to sign contracts or other legal documents for your agency. Page 40 of 319 15 Complete for Acquisition, Housing Rehabilitation and Public Facility Projects 1. Provide a detailed scope covered by this project (identify all phases). 2. Does your agency have experienced staff, or volunteers, or will you hire contractors? 3. Does the project manager have experience with federal procurement regulations and labor requirements? Describe the size and scope of projects previously administered. 4. Does the proposed use meet zoning requirements? ☐ YES ☐ NO Page 41 of 319 16 Complete for Acquisition, Housing Rehabilitation and Public Facility Projects 5. Does your agency own the building or have site control? ☐ YES ☐ NO i. If not, will you own it by May 1, 2018? ☐ YES ☐ NO ☐ N/A ii. Has your agency executed a contract to purchase the property? ☐ YES ☐ NO ☐ N/A iii. Does your agency have a lease? ☐ YES ☐ NO ☐ N/A Please identify term of lease and when it will be renewed. ☐ N/A 6. Will persons or businesses be displaced? ☐ YES ☐ NO i. If yes, does yo ur agency have non-CDBG funding available to pay relocation expenses? ☐ N/A 7. How long will the site be used for its intended purpose? Page 42 of 319 17 I have reviewed this application and agree that the description, goals, impact, budget and other aspects of the described project are reasonable and accurate. I agree that the project will be completed as presented in this application (without modification) if my agency receives CDBG funds. Project Manager Name: Title: Signature: Date: The Statements and data in this application are correct and true to the best of my knowledge, and its submission is authorized by the governing bod y of the applicant. I understand that Arapahoe County may verify an y and all statements contained in this application, and that any false information or omission may disqualify m y agency from further consideration of CDBG funding. I also understand that, upon submission, this application becomes the propert y of Arapahoe County and will not be returned to m y agenc y in whole or in part. Name: Title: Authorized Signature: Date: Page 43 of 319 18 Conflict of Interest Certification Per 2 CFR Part 200, Subpart B §200.112, the non-Federal entity (Sub-recipient) must disclose in writing any potential conflict of interest to the Federal awarding agency or pass-through entity in accordance with applicable Federal awarding agency policy. This document certifies that, to the best of the Sub-recipient’s knowledge:  All financial disclosures related to the activities that may be funded by or through a resulting agreement will be made as required by the Federal Agency Conflict of Interest policy and Arapahoe County Purchasing Policy §1.8, Ethics and Professional Conduct.  All identified conflicts of interest will be or have been satisfactorily managed, reduced or eliminated in accordance with the policies listed above prior to the expenditures of any funds under any resultant agreement and within a timely manner sufficient to enable timely reporting.  Sub-recipient does have an active and/or enforced conflict of interest policy.  Sub-recipient does not have an active and/or enforced conflict of interest policy. ____________________________________________________________ Signature of Authorized Official ____________________________________________________________ Name and Title of Authorized Official ____________________________________________________________ Organization Legal Name _________________________________ _____________________________ Phone Date ____________________________________________________________ Email Page 44 of 319 19 Mandatory Disclosures Certification The applicant for a Federal award must disclose, in a timely manner, in writing to the Federal awarding agency or pass-through entity, all violations of Federal criminal law involving fraud, bribery, or gratuity violations potentially affecting the Federal award. Non-Federal entities that have received a Federal award that include the term and condition outlined in 2 CFR 200 Appendix XII, Award Term and Condition for Recipient Integrity and Performance Matters, are required to report certain civil, criminal, or administrative proceedings to SAM. The sub-recipient certifies the entity and any employee participating in this project: (answer all questions)  are  are not presently debarred, suspended, proposed for debarment, or declared ineligible for award of Federal contracts.  are  are not presently indicted for, or otherwise criminally or civilly charged by a government entity.  have  have not within three years preceding this offer, been convicted of or had a civil judgment rendered against them for commission of fraud or criminal offense in connection with obtaining, attempting to obtain, or performing a public (federal, state or local) contract of subcontract; a violation of Federal or State antitrust statutes relating to the submission of offers; a commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements or receiving stolen property.  have  have not within three (3) years preceding this offer, had one or more contracts terminated for default by any Federal agency The information, certifications and representations above have been read, signed and made by an authorized official of the sub-recipient named herein. The appropriate programmatic and administrative personnel involved in this application are aware of the sponsor policy in regard to sub-awards and are prepared to establish the necessary agreements consistent with those policies. _______________________________________________________________________ Signature of Authorized Official _______________________________________________________________________ Name and Title of Authorized Official _______________________________________________________________________ Organization Legal Name ______________________________ ________________________________ Phone Date _______________________________________________________________________ Email Page 45 of 319 20 Pre-Award Risk Assessment Questionnaire In compliance with CFR 200.331, Arapahoe County must evaluate each organization’s risk of noncompliance with Federal statutes, regulations and terms and conditions of the award agreement. The results of this risk assessment will determine the level of monitoring required if an award agreement is granted by the County. Organization Legal Name: ________________________________________________________________________ Address: ______________________________________________________________________________________ City: ___________________________ State: ___________Zip: __________________________________________ E-mail: ___________________________ Phone: ________________________ Fax: __________________________ Federal Employer Identification Number (EIN) ________________________________________________________ DUNS number__________________________________________________________________________________ Yes No Is the organization owned or controlled by a parent entity? If “Yes”, please provide the following: Parent Entity Legal Name: ________________________________________________________________________ Parent Entity Address: ___________________________________________________________________________ City, State, Zip: _________________________________________________________________________________ Parent Entity Congressional District: ________________________________________________________________ Parent Entity EIN: _______________________________________________________________________________ Parent Entity DUNS: _____________________________________________________________________________ SAM.gov Registration? (Must be completed prior to executing contracts (free registration)) Yes No If yes, SAM.gov Active Exclusions? (Yes means you have active exclusions and are not eligible to receive federal funds; No means you do not have an active exclusion and are eligible to receive federal funds; Please check your SAM.gov status for confirmation) Yes No SAM.gov Delinquent Federal Debt? (In SAM.gov, this is listed as “Debt Subject to Offset?”) Yes No Core Information 1. Facilities and Administrative (F&A) Rates are calculated based on: Our federally-negotiated F&A rates for this type of work. (If this box is checked, please attach a copy Page 46 of 319 21 of your F&A rate agreement or provide a URL link to the agreement.) Other rate (please specify) ____________________________________________________________ Not applicable – Organization is not requesting payment of F&A costs. 2. Fringe Benefit (FB) Rates are calculated based on: Rates consistent with or lower than our federally-negotiated rates. (If this box is checked, please attach a copy of your FB rate agreement or provide a URL link to the agreement.) Other rates (please specify) ____________________________________________________________ 3. Yes No Significant changes in key personnel? If “Yes”, name and title held? __________________________________________________ 4. Yes No Small Business Concern Organization represents that it is a small business concern as defined in 13 CFR 124.1002. Cost Sharing 5. Yes No Cost Sharing, if "Yes": Amount: $_________________________ Cost sharing, matching and/or in-kind amounts and justification should be included in the organization’s budget. Any offered cost share is considered a binding fiscal obligation and must be documented accordingly. How does the organization determine that it has met cost -sharing goals? _________________________________ _____________________________________________________________________________________________ Compliance 6. Yes No Does organization conduct an annual audit in accordance with OMB Regulations (2 CFR Part 200.331 (f), as applicable)? If “Yes”, Most recent fiscal year completed: _____________________ By who? __________________________________________________ If “No”, Organization is a: Non-profit entity below federal funding threshold Foreign entity For profit entity Government entity below funding threshold Please attach a complete copy of your most recent single audit report or independent audit or provide the URL link to a complete copy. 7. Yes No Was the previous years’ audit(s) completed by the same audit firm? If “Yes”, how many years has Page 47 of 319 22 the same firm completed the audit? ________________ 8. Yes No Were any audit findings specifically related to sub-awards? If "Yes," please explain: __________________________________________________________________________ _____________________________________________________________________________________________ _____________________________________________________________________________________________ 9. Does the most recent audit report reveal any of the following? Yes No Material Weakness Yes No Significant Deficiency Yes No Instances of Material Non-compliance If “Yes” to any of the above, indicate what actions are being taken to resolve: _____________________________________________________________________________________________ _____________________________________________________________________________________________ _____________________________________________________________________________________________ Internal Controls 10. Yes No Does your organization have internal controls to prevent the spending of funds in excess of approved budgeted amounts? If “Yes”, please describe: _____________________________________________________________________________________________ _____________________________________________________________________________________________ _____________________________________________________________________________________________ 11. Yes No Does your organization’s procedures ensure that costs deemed unallowable, per the federal guidelines noted above, are excluded from the amount billed to the county under this award agreement? If “Yes”, please describe: _____________________________________________________________________________________________ _____________________________________________________________________________________________ _____________________________________________________________________________________________ 12. Yes No Does the organization have procedures which provide assurance that consistent treatment is applied in the distribution of charges to all grants? 13. Yes No Are duties separated so that no one individual has complete authority over an entire financial transaction? Page 48 of 319 23 14. Yes No Does your organization have bond insurance for employees hand ling cash? 15. Yes No Does your accounting system segregate cost and revenues by funding source? Cash Management 16. Yes No Are all bank accounts reconciled monthly? 17. Yes No Are all costs properly documented with evidence of receipt of goods or performance of services? 18. Yes No Are U.S. Federal Government funds deposited in a separate bank account or accounted for through grant-loan fund control accounts? Payroll 19. Yes No Are payroll charges checked against program/project budgets? What system does your organization use to control paid time, especially time charged to sponsored agreements to ensure accurate allocation of employee time? _____________________________________________________________________________________________ _____________________________________________________________________________________________ Procurement 20. Yes No Are there procedures to ensure purchasing at competitive prices that are compliant with 2 CFR §§200.317-200.326? 21. Yes No Does your organization have the ability to account for equipment purchases greater than $5,000 per item? 22. Yes No Is there an effective system of authorization and approval of Capital equipment costs? 23. Yes No Is there an effective system of authorization and approval of Travel costs? Property Management 24. Yes No Are detailed records of individual capital assets kept and periodically balanced with the general ledger records? 25. Yes No Are there effective procedures for authorizing and accounting for the disposal of property and equipment? 26. Yes No Are detailed property records periodically checked by physical inventory? Briefly describe the organization’s policies concerning capitalization and depreciation: _____________________________________________________________________________________________ _____________________________________________________________________________________________ Page 49 of 319 24 _____________________________________________________________________________________________ Other Compliance 27. Yes No Has your organization received grants, contracts, or cooperative agreements from Arapahoe County Government in the past? 28. Yes No If “Yes”, were any of those agreements terminated early for fiscal negligence or discrepancies, or due to lack of technical progress or misrepresentation of outcomes? 29. Yes No Does your organization engage in any lobbying or partisan political activity which is charged directly or indirectly to a federally assisted program? 30. Yes No Does your organization have a formal system for complying with the Davis -Bacon Act which requires payment of prevailing wages on Federal contracts? If “Yes”, please describe: _____________________________________________________________________________________________ _____________________________________________________________________________________________ _____________________________________________________________________________________________ 31. Yes No Does your organization have a formal policy of non-discrimination and a formal system for complying with U.S. Federal civil rights requirements? 32. Yes No Does your organization have a cash forecasting process which will minimize the time elapsed between the drawing down of funds and the disbursement of those funds? 33. Yes No Is your organization familiar with the U.S. Government Federal Financial Reports requirements that the reports be completed in an accurate and timely manner when required? Should this risk assessment indicate the potential need, Arapahoe County reserves the right to conduct additional monitoring by any combination of requesting audit reports, performing random audits, performing site visits to observe program operations, review preliminary financial records, or other actions as necessary. The information above has been read, completed and signed by an authorized official of the Organization named herein. The appropriate programmatic and administrative personnel involved in this application are aw are of sponsor policy in regard to sub-awards and are prepared to establish the necessary agreements consistent with those policie s. Signature of Authorized Official Date Name and Title of Authorized Official Organization Legal Name Phone Email Page 50 of 319 25 List of Attachments: Attachment A: Organizational Budget Attachment B: Balance Sheet Attachment C: Income Statement Attachment D: Cashflow Statement Attachment E: Statement of Shareholders’ Equity Attachment F: Financial Audit with Management Letter Attachment G: Articles of Incorporation / Bylaws Attachment H: Non-profit Determination / Tax Status Certification Attachment I: W-9 Attachment J: Board of Directors Attachment K: Designation of Authorized Official / Signatory Resolution Attachment L: Organization Chart Attachment M: Key Staff Resumes Attachment N: Employee Conflict of Interest Policy Attachment O: Procurement Polic y Attachment P: References Attachment Q: Agency Application Form and/or Intake Form for Client Services Attachment R: Project Service Area Map Attachment S: Project Drawings and Specifications (Public Facility and Infrastructure) Attachment T: Capital Needs Assessment Attachment U: Lease Agreement Optional Attachments: Attachment V: Letter(s) of Support Attachment W: Agency Brochures and Marketing Materials Attachment X: Project Photographs Attachment Y: Other Relevant Documents Page 51 of 319 26 Attachment A: Organizational Budget Page 52 of 319 27 Attachment B: Balance Sheet Page 53 of 319 28 Attachment C: Inco me Statement Page 54 of 319 29 Attachment D: Cashflow Statement Page 55 of 319 30 Attachment E: Statement of Shareholders’ Equity Page 56 of 319 31 Attachment F: Financial Audit with Manage ment Letter Page 57 of 319 32 Attachment G: Articles of Incorporation / Bylaw s Page 58 of 319 33 Attachment H: Non-profit Determination / Tax Status Certification Page 59 of 319 34 Attachment I: W-9 Page 60 of 319 35 Attachment J: Board of Directors Page 61 of 319 36 Attachment K: Designation of Authorized Official Page 62 of 319 37 Attachment L: Organization Chart Page 63 of 319 38 Attachment M : Key Staff Resumes Page 64 of 319 39 Attachment N: Employee Conflict of Interest Policy Page 65 of 319 40 Attachment O: Procurement Policy Page 66 of 319 41 Attachment P: References Page 67 of 319 42 Attachment Q: Application Form / Intake Form for Client Services Page 68 of 319 43 Attachment R: Project Service Area Map Page 69 of 319 44 Attachment S: Project Drawings and Specifications,(Public Facility and Infrastructure) Page 70 of 319 45 Attachment T: Capital Needs Assessment Page 71 of 319 46 Attachment U: Lease Agreement (If Applicable) Page 72 of 319 47 Attachment V: Letter(s) of Support Page 73 of 319 48 Attachment W: Agency Brochures and Marketing Materials Page 74 of 319 49 Attachment X: Project Photographs Page 75 of 319 50 Attachment Y: Other Relevant Documents Page 76 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Audra Kirk DEPARTMENT: Community Development DATE: October 16, 2017 SUBJECT: Council Bill 66 - 3333, 3323, 3317 South Pearl Street Planned Unit Development DESCRIPTION: Council Bill 66 - 3333, 3323, 3317 South Pearl Street Planned Unit Development RECOMMENDATION: Staff recommends Council approve a Bill for an Ordinance approving 3333, 3323, 3317 South Pearl Street Planned Unit Development. PREVIOUS COUNCIL ACTION: There has been no previous Council action concerning the proposed 3333, 3323, 3317 South Pearl Street Planned Unit Development (PUD). SUMMARY: ANALYSIS: The Planned Unit Development is a rezoning process that establishes specific zoning and site planning criteria to meet the needs of a specific development proposal that may not be accommodated within existing zoning development regulations. A PUD rezoning provides the opportunity for unified development control for multiple properties or multiple uses. The property at 3317 South Pearl Street contains an existing single-family home that was built in 1987, and a detached garage. The lot at 3317 South Pearl Street is 6,250 s.f. in area. The property at 3323 South Pearl Street contains a single-family home built in 1950, and a detached garage. The lot at 3323 is 6,250 s.f. in area. The property at 3333 South Pearl Street contains a single family home built in 1943, and has a lot area of 9,375 s.f. The minimum threshold requirement to re-zone any property to a PUD is ½ acre of total land area. Mr. Adragna of 3333 South Pearl Street was able to acquire this minimum threshold by including two of his neighbors to the north into the PUD rezoning. While the three property owners will be included in the PUD, if approved, the development may not happen at the same time. PUD OVERVIEW Page 77 of 319 The proposed 3333, 3323, 3317 South Pearl Street PUD will allow a maximum of one (1) three unit dwelling, two (2) two-unit dwellings, and three (3) detached garages. Each unit will be required to have 2 off-street parking spaces. All of the designated parking is accessed from the alley, and meets the City’s parking regulations. The proposed new homes are set back approximately 25 feet from South Pearl Street to be compatible with the existing structures to the north and south. The PUD District Development Standards require that landscaping and screening comply with the City of Englewood Unified Development Code Section 16-6-7. All new utilities are to be placed underground between the garages and the residences. A Minor Subdivision application to reconfigure the lots will be submitted, and will be approved administratively if the PUD application is approved. Architectural Character: The proposed PUD will be urban in character and respect the pedestrian scale of the neighborhood. The PUD contains architectural character standards that require a mix of pattern and color changes, a minimum masonry requirement, and a requirement that building entries be clearly defined with architectural elements. It should be noted that the conceptual building footprints shown on the Proposed Site Plan and the proposed building elevations are subject to change; however, any changes would have to meet the design standards and guidelines of the PUD. Permitted Uses: The subject property currently lies within the R-1-C Single Unit Residential District. The existing R-1-C Zone District allows primarily residential and public/institutional uses.The proposed PUD District Plan includes a table of allowed uses that lists the pr imary permitted residential and public/institutional uses. Dimensional Standards: The following table provides a comparison of dimensional requirements for principal structures between the property’s existing R-1-C zone classification and the proposed PUD. The proposed PUD is very similar to the R-2-B zone district, however, there are important differences. First, in the R-2-B zone district, the minimum lot area for a single family home is 6,000 s.f., and a minimum of 50 feet of street frontage. The proposed PUD would allow a single family home to be built on a 4,500 s.f. with 37 ½ feet of street frontage. Other zone district do allow for homes to be built on a 4,500 s.f. lot, however, they must be lots of record on or before February 23, 2004. Secondly, the R-2-B zone district has a maximum lot coverage of 60% for multi-unit dwellings. The proposed PUD has a maximum lot coverage for 50% for multi-unit dwellings. The dimensional requirements set forth in the proposed PUD would allow multi-unit dwellings (based on lot area and lot width), and single family dwellings on a 37 ½’ lot. COMPARISON OF DIMENSIONAL REQUIREMENTS FOR PRINCIPAL STRUCTURES Min Lot Area (sq ft) Max FAR Max Lot Coverage (%) Min Lot Width (ft) Max Height (ft) Minimum Setbacks (ft) Front Each Side Rear R-1-C District (Existing Zoning) Page 78 of 319 One-Unit Dwelling 6,000 None 40 50 32 25 5 20 One-Unit Dwelling on a Small Lot (must be an existing lot) 4,500 None 35 37 32 25 3 20 All Other Allowed Uses 24,000 None 40 200 32 25 25 25 3333, 3323, 3317 South Pearl Street PUD (New Zoning) One-Unit Dwelling 4,500 None 40 37.5 32 25 5 20 Multi-Unit Dwelling (Maximum units based on lot area and lot width) 3,000 Per unit None 50 25 per unit 32 25 5 25 All Other Allowed Uses 24,000 None 40 200 32 25 25 25 Residential Density: The proposed 3333, 3323, 3317 South Pearl Street PUD would permit a maximum of 7 dwelling units on the 0.5 acre property. This represents a maximum density of 14 dwelling units per acre (d.u./ac.). For comparison purposes, some properties to the east of subject property contain multi-unit apartment buildings with densities of 60 d.u./ac and higher. Properties to the west in the R-1-C zone district could have a maximum density of 7 d.u./ac. Allowing for a slight increase in density between the R-1-C zone district and the MU-R-3-C zone district, complies with the 2016 Comprehensive Plan to create a transition zone between the medical zone districts and the residential. The 2016 Comprehensive Plan defines Areas of Transition as, “Location of diversified land use including medium to high density housing and medical office.” Setbacks: A setback is the minimum distance a structure must be located from a property line. The proposed PUD setbacks for principal structures are shown in the table of Dimensional Requirements above. The proposed setbacks, maximum area and height regulations for detached accessory structures are as follows: Use Maximum Number Maximum Height Front Setback Side Setback Rear Setback Maximum Floor Area Detached Garage 1 per dwelling unit 16’ 25’ 3’ 6’ 1000 s.f. Storage 1 10’ 25’ 3’ 3’ 150 s.f. Page 79 of 319 Shed Other Accessory Structure 1 12’ 25’ 3’ 3’ 200 s.f. Building Height: The maximum building heights in the PUD are based on the average elevation of the finished grade at the corners of the building to the highest point of the building or structure. The maximum allowed PUD building height for all uses is 32 feet; the maximum allowed height for garages without a detached accessory structure is 16 feet. Parking: The UDC requires 2 parking spaces for each single-unit dwelling and 1.5 parking spaces for each multi-unit dwelling. The proposed PUD requires 2 parking spaces for each multi-unit dwelling. Traffic: The Public Works Department reviewed the proposed PUD request for potential impacts. Public Works concluded that a traffic impact study was not required due to the slight increase in traffic over the existing permitted density. Signage: The proposed PUD will follow the standard signage regulations of the UDC for the R - 1-C Zone District. Landscaping: The UDC requires that a minimum of 40% of a property be landscaped in the R- 1-C Zone District. The proposed PUD also requires that 40% of the PUD property be landscaped, as well as meeting all other landscape requirements for the R-1-C Zone District. Sheet 07 of the PUD provides more detail on the landscape plan. Screening and Fencing: The proposed PUD will follow the standard screening and fencing regulations of the UDC for the R-1-C Zone District. Grading and Drainage: The proposed Grading and Drainage Plan was acceptable to the City’s Public Works Department. Utilities: The proposed Utilities Plan was reviewed and approved by the City’s Utilities Department. Park Dedication: The subdivision regulations of the UDC require the dedication of park land or payment of a fee in lieu of dedication for all residential developments. The proposed Pearl Street development will be required to pay a fee in lieu of dedication for the 4 to 7 new residences. This translates to a fee in lieu of dedication amount of between $1,690 and $3,070. PLANNED UNIT DEVELOPMENT CONSIDERATIONS Section 16-2-8.F Approval Criteria states: PUD rezonings shall be made in the interest of promoting the health, safety, and general welfare of the community, and shall be consistent with the Comprehensive Plan. In addition the review or decision making body shall only recommend approval of, or shall only approve, a proposed PUD rezoning if it finds that the proposed rezoning meets the criteria listed below: 1. The proposed development shall comply with all applicable use, development, and design standards set forth in this Title that are not otherwise modified or waived according to the Page 80 of 319 rezoning approval. In addition, the proposed rezoning shall meet at least one of the following criteria: 1. The proposed development will exceed the development quality standards; levels of public amenities; or levels of design innovation otherwise applicable under this Title, and the proposed development would not be allowed or practicable under a standard zone district with conditional uses or with a reasonable number of Zoning Variances or Administrative Adjustments; or 1. The property cannot be developed, or no reasonable economic use of the property can be achieved, under the existing zoning, even though the use of the conditional uses or a reasonable number of Zoning Variances or Administrative Adjustments. The proposed PUD meets the criteria of 1a. The proposed PUD will exceed the current UDC quality standards by specifying a variety of materials on facades of the building; by calling for a minimum masonry percentage or defined porch on the front façade; and by requiring rear loaded garages. The PUD contains architectural character standards that require a mix of pattern and color changes, and a requirement that building entries be clearly defined with architectural elements. Provisions for roof pitches and flat roofs are also included in the PUD. The proposed PUD further meets the requirement of 1a due to the fact that there are not any conditional uses allowed by the UDC that would allow for multi-family dwellings in an R-1-C zone district or allow a single family dwelling on a 37 1/2’ wide lot. In addition, the Board of Adjustments and Appeals can not grant a variance, nor can staff grant an Administrative Adjustment for an increase in density or a reduction in lot area that would increase density. 2. All PUD rezoning shall meet the following criterion: 1. The resulting rezoned property will not have a significant negative impact on those properties surrounding the rezoned area and the general public health, safety and welfare of the community will be protected. The Public Works Department reviewed the proposed PUD request and concluded that there were not significant traffic impacts with this minor increase in permitted density. The rezoned property will not have a significant negative impact on those properties surrounding the rezoned area and the general public health, safety and welfare of the community are protected. 16-2-8.H.4(a): In its review of the PUD application, in addition to any other criteria and findings applicable to the decision, the Commission’s recommendations shall include its written findings on each of the following points: 1. The application is or is not in conformance with the Comprehensive Plan and this Title. The 3333, 3323, 3317 South Pearl Street PUD conforms to the Englewood Forward: 2016 Comprehensive Plan strategy of redevelopment. Part 3, Envisioning the Plan, lists this area as Page 81 of 319 a Residential Transition Area. Specifically, this area is to, “Explore residential redevelopment plans that promote infill townhome development between the hospitals and single family neighborhoods to the north to provide a transitional zone that will diversify land use mix, provide opportunities for new housing and home ownership.” 2. The application is or is not consistent with adopted and generally accepted standards of development in the City. The 3333, 3323, 3317 South Pearl Street PUD is consistent with adopted and generally accepted development standards established by the City of Englewood. The application was reviewed by the City’s Development Review Team (DRT) and all comments were addressed by the applicant. 3. The application is or is not substantially consistent with the goals, objectives, design guidelines, policies and any other ordinance, law, or requirement of the City. The 3333, 3323, 3317 South Pearl Street PUD is substantially consistent with the goals, objectives, design guidelines, policies, and other ordinances, laws and requirements of the City. FINANCIAL IMPLICATIONS: The proposed 3333, 3323, 3317 South Pearl Street PUD will generate building use tax, based on the total cost of the project and park fee-in-lieu, of between $1,690 and $3,070 depending on the final number of units built. ATTACHMENTS: Bill for an Ordinance 3333, 3323, 3317 South Pearl Street Planned Unit Development Planning and Zoning Commission Staff Report - September 6, 2017 Neighborhood Meeting Summary - June 9, 2017 Letter of Support - June 7, 2017 Survey Conducted by Applicant - June 22, 2017 Planning and Zoning Commission Minutes - September 6, 2017 Planning and Zoning Commission Findings of Fact - September 6, 2017 Emails Page 82 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 66 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER ________________ BILL FOR AN ORDINANCE APPROVING THE 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT (PUD), LOCATED AT 3333, 3323, AND 3317 SOUTH PEARL STREET, IN THE CITY OF ENGLEWOOD, COLORADO. WHEREAS, Casey and Amy Adragna are the owners of 3333 South Pearl Street, Scott and Elizabeth Brann are the owners of 3323 South Pearl Street; and Kelley Rhodes is the owner of 3317 South Pearl Street; and WHEREAS, the proposed site consists of three parcels totaling one-half acre, the minimum threshold for a Planned Unit Development (PUD); and WHEREAS, the properties currently lie in a R-1-C Zone District which allows for residential and public/institutional uses; and WHEREAS, a PUD is a rezoning process that establishes specific zoning and site planning criteria to meet the needs of a specific development proposal that may not be accommodated within the existing zoning development regulations. The PUD rezoning provides the opportunity for unified development control for multiple properties or multiple uses; and WHEREAS, currently the property at 3333 South Pearl Street contains a single-family home that was built in 1943, the property at 3323 South Pearl Street contains a single-family with a detached garage that was built in 1950, and the property at 3317 South Pearl Street contains an existing single-family residence with a detached garage that was built in 1987; and WHEREAS, the proposed PUD will allow a maximum of one (1) three unit dwelling, two (2) two-unit dwellings, and three (3) detached garages. Each unit will be required to have two (2) off street parking spaces. The proposed new homes are setback approximately twenty-five (25) feet from South Pearl Street to be compatible with the existing structures to the North and South. All new utilities will be placed underground, and the PUD Development Standards require that landscaping and screening comply with the City of Englewood Unified Development Code Section 16-6-7; and WHEREAS, the proposed PUD will be urban in character and respect the pedestrian scale of the neighborhood. The PUD contains architectural standards that require a mix of pattern and color changes, a minimum masonry requirement, and a requirement that building entries be clearly defined with architectural elements; and Page 83 of 319 2 WHEREAS, 3333, 3323, 3317 S. Pearl Street Planned Unit Development submitted an application to rezone the property to a PUD because the existing zoning designation would not accommodate the proposed development; and WHEREAS, the proposed 3333, 3323, 3317 S. Pearl Street Planned Unit Development will exceed the development quality standards required by the Englewood Unified Development Code for residential development; and WHEREAS, the property cannot be developed, or no reasonable economic use of the property can be achieved, under the existing zoning, even through the use of conditional uses or a reasonable number of Zoning Variances or Administrative Adjustments; and WHEREAS, the Planning and Zoning Commission held Public Hearing on September 6, 2017; and WHEREAS, the Planning and Zoning Commission made the following findings: 1. That the proposed development would be possible or practicable under a standard R-2-B zone district. 2. That the property can be developed, or that reasonable economic use of the property can be achieved, under the existing zoning, even through the use of conditional uses or Administrative Adjustment. WHEREAS, the Planning and Zoning Commission recommended that the 3333, 3323, 3317 S. Pearl Street Planned Unit Development not be approved; and WHEREAS, the proposed use of the property cannot meet the requirements of Englewood Unified Development Code Section 16-6-8(F), without a PUD, in that there are not any conditional uses allowed by the UDC that would allow for multi-family dwellings in the R-1-C zone district or allow a single family dwelling on 37 ½’ wide lot; and WHEREAS, the Board of Adjustment and Appeals cannot grant a variance, nor can staff grant Administrative Adjustments for an increase in density or reduction in lot area that would increase density; and WHEREAS, the proposed PUD complies with the 2016 Comprehensive Plan to create transition zones between the medical zone districts and residential districts, and the 2016 Comprehensive Plan defines Areas of Transition as “Location of diversified land use including medium to high density housing and medical office”; and WHEREAS, the proposed PUD conforms to the Englewood Forward: 2016 Comprehensive Plan strategy of redevelopment, that it is consistent with adopted and generally accepted development standards adopted by the City of Englewood, and it is substantially consistent with the goals, objectives, design guidelines, policies, and other ordinances, laws and requirements of the City. Page 84 of 319 3 NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, AS FOLLOWS: Section 1. The 3333, 3323, 3317 S. Pearl Street Planned Unit Development (PUD), for property located at 3333, 3323 and 3317 South Pearl Street, in the City of Englewood, Colorado, attached hereto as Exhibit A, is hereby approved. Introduced, read in full, and passed on first reading on the 16th day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 19th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 18th day of October, 2017 for thirty (30) days. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile Acting, City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Bill for Ordinance introduced, read in full, and passed on first reading on the 16th day of October, 2017. Stephanie Carlile Page 85 of 319 TO:Planning and Zoning Commission THRU:Brad Power, Community Development Director Harold Stitt, Senior Planner FROM:Audra L. Kirk, Planner II DATE:September 6, 2017 SUBJECT: Case ZON2017-002 - Public Hearing 3333, 3323, 3317 South Pearl Street Planned Unit Development APPLICANT: Casey Adragna 2192 West Caley Avenue Littleton, CO 80120 PROPERTY OWNER(S): Casey and Amy Adragna 2192 West Caley Avenue Littleton, CO 80120 Scott and Elizabeth Brann 8474 South Brentwood Street Littleton, CO 80128 Kelley Rhodes 3317 South Pearl Street Englewood, CO 80113 PROPERTY ADDRESSES: 3317, 3323 and 3333 South Pearl Street, Englewood, CO 80113 REQUEST: The applicant has submitted an application to rezone the properties above from R-1-C Single Unit Residential District (Small Lot Size) to the 3333, 3323, 3317 South Pearl Street Planned Unit Development (PUD). The proposed PUD would allow for a maximum of one (1) single-family attached dwellings with three (3) units, and two (2) single-family attached dwellings with two (2) units. Page 86 of 319 2 RECOMMENDATION: Case ZON2017-002: The Department of Community Development recommends that the Planning and Zoning Commission review the 3333, 3323, 3317 South Pearl Street PUD request and forward a favorable recommendation for approval to City Council. LEGAL DESCRIPTIONS: 3333 South Pearl Street: Lots 40-42 Block 3 West View 3323 South Pearl Street: Lots 43-44 Block 3 West View 3317 South Pearl Street: Lots 45-46 Block 3 West View EXISTING ZONE DISTRICT: R-1-C Single Unit Residential District (Small Lot Size) PROPERTY LOCATION AND SURROUNDING LAND USE: The subject properties of this PUD are located on South Pearl Street between East Floyd Avenue and East Girard Avenue. Land to the north, south, and west of the subject property is zoned R-1-C Single Unit Residential District. Land directly to the east of the subject property is zoned MU-R-3-C High Density Residential and Limited Office District. PUD PROCEDURE: Rezoning to a PUD requires the applicant to have a pre-application meeting with staff, and a neighborhood meeting with owners and neighbors located within 1,000 feet of the proposed PUD. After the neighborhood meeting a formal application is submitted to the City and reviewed by City departments and other affected outside agencies. A public hearing is held before the Planning and Zoning Commission and City Council. If the PUD is approved there is a 30 day referendum time period before becoming effective. BACKGROUND: The Planned Unit Development is a rezoning process that establishes specific zoning and site planning criteria to meet the needs of a specific development proposal that may not be accommodated within existing zoning development regulations. A PUD rezoning provides the opportunity for unified development control for multiple properties or multiple uses. The property at 3317 South Pearl Street contains an existing single-family home that was built in 1987, and a detached garage. The lot at 3317 South Pearl Street is 6,250 s.f. in area. The property at 3323 South Pearl Street contains a single-family home built in 1950, and a detached garage. The lot at 3323 is 6,250 s.f. in area. The property at 3333 South Pearl Street contains a single family home built in 1943, and has a lot area of 9,375 s.f. The minimum threshold requirement to re-zone any property to a PUD is ½ acre of total land area. Mr. Adragna of 3333 South Pearl Street was able to acquire this minimum threshold by including two of his neighbors to the north into the PUD rezoning. While the three property owners will be included in the PUD, if approved, the development may not happen at the same time. Page 87 of 319 3 NEIGHBORHOOD MEETING SUMMARY: Pursuant to the PUD procedure, the applicant conducted a neighborhood meeting on June 6, 2017, prior to submitting the application for a PUD rezoning on July 28, 2017. Notice of the pre-application meeting was mailed to property owners and occupants of property within 1000 feet of the site. Neighborhood meeting notes are attached to this report (See Exhibit B). In addition to the neighborhood meeting, the applicant also conducted a survey of residence on the 3300 block of South Pearl Street. The survey asked if neighbors would rather see a PUD with zoning to match the MU-R-3-C that is currently on the east side of South Pearl Street of if they would like to see a lower density with duplexes and townhomes. (See Exhibit D). CITY DEPARTMENT AND DIVISION REVIEW: The 3333, 3323 and 3317 South Pearl Street PUD was reviewed by the City’s Development Review Team (DRT) on August 8, 2017. Identified issues were addressed by the applicant and the final 3333, 3323, 3317 South Pearl Street PUD was submitted on August 23, 2017. PUD OVERVIEW: The proposed 3333, 3323, 3317 South Pearl Street PUD will allow a maximum of one (1) three unit dwelling, two (2) two-unit dwellings, and three (3) detached garages. Each unit will be required to have 2 off-street parking spaces. All of the designated parking is accessed from the alley, and meets the City’s parking regulations. The proposed new homes are setback approximately 25 feet from South Pearl Street to be compatible with the existing structures to the north and south. The PUD District Development Standards require that landscaping and screening comply with the City of Englewood Unified Development Code Section 16-6-7. All new utilities are to be placed underground between the garages and the residences. A Minor Subdivision application to reconfigure the lots will be submitted, and will be approved administratively if the PUD application is approved. Architectural Character: The proposed PUD will be urban in character and respect the pedestrian scale of the neighborhood. The PUD contains architectural character standards that require a mix of pattern and color changes, a minimum masonry requirement, and a requirement that building entries be clearly defined with architectural elements. It should be noted that the conceptual building footprints shown on the Proposed Site Plan and the proposed building elevations are subject to change; however, any changes would have to meet the design standards and guidelines of the PUD. Permitted Uses: The subject property currently lies within the R-1-C Single Unit Residential District. The existing R-1-C Zone District allows primarily residential and public/institutional uses. The proposed PUD District Plan includes a table of allowed uses that lists the primary permitted residential and public/institutional uses. Page 88 of 319 4 Dimensional Standards: The following table provides a comparison of dimensional requirements for principal structures between the property’s existing R-1-C zone classification and the proposed PUD. COMPARISON OF DIMENSIONAL REQUIREMENTS FOR PRINCIPAL STRUCTURES Minimum Setbacks (ft)Min Lot Area (sq ft) Max FAR Max Lot Coverage (%) Min Lot Width (ft) Max Height (ft)Front Each Side Rear R-1-C District (Existing Zoning) One-Unit Dwelling 6,000 None 40 50 32 25 5 20 One-Unit Dwelling on a Small Lot 4,500 None 35 37 32 25 3 20 All Other Allowed Uses 24,000 None 40 200 32 25 25 25 3333, 3323, 3317 South Pearl Street PUD (New Zoning) One-Unit Dwelling 4,500 None 40 37.5 32 25 5 20 Multi-Unit Dwelling (Maximum units based on lot area and lot width) 3,000 Per unit None 50 25 per unit 32 25 5 25 All Other Allowed Uses 24,000 None 40 200 32 25 25 25 Residential Density: The proposed 3333, 3323, 3317 South Pearl Street PUD would permit a maximum of 7 dwelling units on the 0.5 acre property. This represents a maximum density of 14 dwelling units per acre (d.u./ac.). For comparison purposes, some properties to the east of subject property contain multi-unit apartment buildings with densities of 60 d.u./ac and higher. Properties to the west in the R-1-C zone district could have a maximum density of 7 d.u./ac. Setbacks: A setback is the minimum distance a structure must be located from a property line. The proposed PUD setbacks for principal structures are shown in the table of Dimensional Requirements above. The proposed setbacks, maximum area and height regulations for detached accessory structures are as follows: Use Maximum Number Maximum Height Front Setback Side Setback Rear Setback Maximum Floor Area Detached Garage 1 per dwelling unit 16’25’3’6’1000 s.f. Page 89 of 319 5 Storage Shed 1 10’25’3’3’150 s.f. Other Accessory Structure 1 12’25’3’3’200 s.f. Building Height: The maximum building heights in the PUD are based on the average elevation of the finished grade at the corners of the building to the highest point of the building or structure. The maximum allowed PUD building height for all uses is 32 feet; the maximum allowed height for garages without a detached accessory structure is 16 feet. Parking: The UDC requires 2 parking spaces for each single-unit dwelling and 1.5 parking spaces for each multi-unit dwelling. The proposed PUD requires 2 parking spaces for each multi-unit dwelling. Traffic: The Public Works Department reviewed the proposed PUD request for potential impacts. Public Works concluded that a traffic impact study was not required due to the slight increase in traffic over the existing permitted density. Signage: The proposed PUD will follow the standard signage regulations of the UDC for the R-1-C Zone District. Landscaping: The UDC requires that a minimum of 40% of a property be landscaped in the R-1-C Zone District. The proposed PUD also requires that 40% of the PUD property be landscaped, as well as meeting all other landscape requirements for the R- 1-C Zone District. Sheet 07 of the PUD provides more detail on the landscape plan. Screening and Fencing: The proposed PUD will follow the standard screening and fencing regulations of the UDC for the R-1-C Zone District. Grading and Drainage: The proposed Grading and Drainage Plan was acceptable to the City’s Public Works Department. Utilities: The proposed Utilities Plan was reviewed and approved by the City’s Utilities Department. Park Dedication: The subdivision regulations of the UDC require the dedication of park land or payment of a fee in lieu of dedication for all residential developments. The proposed Pearl Street development will be required to pay a fee in lieu of dedication for the 4 to 7 new residences. This translates to a fee in lieu of dedication amount of between $1,690 and $3,070. PUD SUMMARY: The proposed 3333, 3323, 3317 South Pearl Street PUD has been reviewed by the City’s Development Review Team (DRT) and issues identified by the DRT were Page 90 of 319 6 addressed by the applicant. The PUD documents are complete and no additional conditions of approval are recommended at this time. Therefore, the Community Development Department recommends that the Planning and Zoning Commission review the 3333, 3323, 3317 South Pearl Street PUD request and forward a favorable recommendation for approval to City Council. PLANNED UNIT DEVELOPMENT CONSIDERATIONS: The Planning and Zoning Commission is to review 3333, 3323, 3317 South Pearl Street PUD request, and following the public hearing, may recommend that the Council approve, deny, or approve the rezoning with conditions. In its review of the application, the Commission’s recommendations should include findings on each of the following points: 1. The application is or is not in conformance with the Comprehensive Plan and this Title (UDC). The 3333, 3323, 3317 South Pearl Street PUD conforms to the Englewood Forward: 2016 Comprehensive Plan strategy of redevelopment. Part 3, Envisioning the Plan, lists this area as a Residential Transition Area. Specifically, this area is to, “Explore residential redevelopment plans that promote infill townhome development between the hospitals and single family neighborhoods to the north to provide a transitional zone that will diversify land use mix, provide opportunities for new housing and home ownership.” 2. The application is or is not consistent with adopted and generally accepted standards of development in the City. The 3333, 3323, 3317 South Pearl Street PUD is consistent with adopted and generally accepted development standards established by the City of Englewood. The application was reviewed by the City’s Development Review Team (DRT) and all comments were addressed by the applicant. 3. The application is or is not substantially consistent with the goals, objectives, design guidelines, policies and any other ordinance, law, or requirement of the City. The 3333, 3323, 3317 South Pearl Street PUD is substantially consistent with the goals, objectives, design guidelines, policies, and other ordinances, laws and requirements of the City. 4. The UDC requires that the review or decision making body shall only approve a proposed PUD if it finds that the proposed development complies with all applicable use, development, and design standards set forth in the UDC that are not otherwise modified or waived according to the rezoning approval; and the proposed rezoning meets one of the following criteria: a. That the proposed development will exceed the development quality standards, levels of public amenities, or levels of design innovation otherwise applicable under Page 91 of 319 7 this Title, and would not be possible or practicable under a standard zone district with conditional uses or with a reasonable number of Zoning Variances or Administrative Adjustments; or The proposed PUD will exceed the development quality standards required by the UDC for residential development as follows: The proposed PUD will exceed the current UDC quality standards by specifying a variety of materials on facades of the building; by calling for a minimum masonry percentage or defined porch on the front façade; and by requiring rear loaded garages. The PUD contains architectural character standards that require a mix of pattern and color changes, and a requirement that building entries be clearly defined with architectural elements. Provisions for roof pitches and flat roofs are also included in the PUD. b. That the property cannot be developed, or that no reasonable economic use of the property can be achieved, under the existing zoning, even through the use of conditional uses or a reasonable number of Zoning Variances or Administrative Adjustments. These properties are in an R-1-C zone district and would be able to be redeveloped into single-family homes. In addition to the two Planned Unit Development considerations above, the UDC requires that a property rezoned to PUD must not have a significant negative impact on those properties surrounding the rezoned area and that the general public health, safety and welfare of the community are protected. Staff has reviewed the PUD request and found the following: The PUD application is in conformance with the Englewood Forward: 2016 Comprehensive Plan and the Unified Development Code. The application is consistent with adopted and generally accepted standards of development in the City. The Public Works Department reviewed the proposed PUD request and concluded that there were not significant traffic impacts with this minor increase in permitted density. The rezoned property will not have a significant negative impact on those properties surrounding the rezoned area and the general public health, safety and welfare of the community are protected. ATTACHMENTS: Exhibit A: 3333, 3323, 3317 South Pearl Street PUD Exhibit B: Neighborhood Meeting Summary – June 9, 2017 Exhibit C: Letter of support from Shawn Koons – June 7, 2017 Page 92 of 319 8 Exhibit D: Survey done by applicant dated June 22, 2017 Page 93 of 319 4.143 88.8333moon:_umm_._£32aca zmE_auo.._..oo.___smm:am _<_m=m<932 ...:am9B3 >:maammmH>oo3x_3m.m_<no >_ama~_uSmmma.m:oa Ommm<>a.muammm<mmEa%w2._2_o=2=5u8_.mo..Im mamaam.am6 mmmaanmacoSE.woo:w_<__oam__mwamaaQ88mos»:_umm_._mamamanSaa _Am__m<maoamm3mm:mos»:_umm_._mama._<__..>a_.mmamoSam m"88 mos": _umm_._mamammm«mam.o3um:<. _<__..>a_.mmam«E8am"ammo8om:<oSamamSoca56 8 am<mEm mo2 8 Eama:o_mxoa.SooqSmmo.Sam88manm33.9oa :5 E.Sam _o».=m__ cazmSmqm8cmUS:Hamomam:<3"ammqmmSocaaaoqmmmm3 oa_<A :38.Im mxU_m_amaEm."amamSacoSocaam<mm_3=m.a_3mam8am_m?maamammm"am m-~-mNoam23.0..2.3=:mmmxomuzoamu a.Oamca:aSmaomoma:m<mm3.33:3_o.mamm238 ma. N._.am333:3.2Saza3..moamca:aSm___amSocaummam. m._<_c_=.ca=aSm___ammSocaam<mm3mx.3:3_o.oo<m.mmmo?woe... _<_a>a«mmammxa_m_amaEm"NoamEmao?m:m:m__<_._m<moocaamamm.3 3m m__m<. maaaoSm3aa_mo?Smmqmmn.Imsamcocaamamm_a3m m__m<Em<ma~mmacmmoa mcoammmeg:_umm_._m._.mm._Emmmm.mam_m3c=3m3__<NoaammaaEm Smmnmam m_am_m33.2Noaaam. _<_a>a.mmamum<mmm<m.m_mxm3u_mm2Sam»a?mmo?a:.o_mxmmmaaa_o_mxmm nocacm3...:53. ImEmaoomama31.02cu8ancmmzoam\oo33ma~m\ooaom_.am. Ocmmzoam\oo33ma8\ooanm3m a._._m<m<o:ammmmaoamaSam.Em<<=_no8oc_.ao3m<m_:mm..v.<mm.Emao3m<m_:mS:aoqmmwm. __<m__<ma3mau_mSoon_8..3<mm_.m_u6_.mo~m__xmEm<<=_ax Em .34mm=:oE_.m. m._f-oNoaam<5:cmnouamaco.<0:nmammmEm.amuumaaom__.mmn_<..OE.u8a3:<836:amam=<<<=_ma:cm3:_mmmEma Samwmmo_.ommSm m=mmw L.._.amoSam_.2$8mac":vmmam=mm.mama.Emaoamaommmaacomnmamm8amqm aocmmnmanow.M-m23mm32mEma=maoca.dammzmm:9.ma onuo:ca:<8 ooazacm8__<mEmqm. >3mn:3m:.n m Page 94 of 319 Page 95 of 319 Page 96 of 319 Page 97 of 319 Page 98 of 319 Page 99 of 319 _u_m::_:cmanNoaau0o_.:3_mm.o: mmEm_.:uma9 no‘.N HOowomm?lmwcmtoIma?zmmomDam~o282.8~ _uo_.>mm._._m.>um.~=_2. Om?._.o$:_m< Um_.<__A__._8: _sm_.o_u.=_:om .__o_.=.mzox=so<mams 2_=8_uBm::3Ammnoanmaas vain:2.3.3 No:Em... §_o_._w_m>52: $53..Oo_m3m: lDX><>(><><)<><>(>< oo .5020:o>xm_mo. oo33_mm_o:m..mEmocmmmqEmnmmmmanSmo_.=m.._m.Oo_.:3_mm_o:m~w Sm: <o.mnmanm.m8aSm...2:939. _<_o<ma_u<_so3um_.mo:Em: wmnoanmn3.32:62.3:8m_.mm3._.m \:uwmo<moxmmNOZMS38.93N88.>2D88WOCWInms?. msmmma3.>22mDC22.om<m53:m2§2oEOZSSIDHO 0:.< OOCZOFS\:.Ibm><om>m..mm.mOO?=SmZDb102. m2.>mu.:m»>cu.m_:an _<_=$1_.mm:.__.m.m8o.a3asx we:Em:=<_o<m...._msx 02m.wosS_m<x Um2_x__._8:x .<_m_.oEaaomx 3::mi,x _um:_ox_<_3.ax .<=n:m_m>52:x 33%..oo_m3m:x amo _<_o:o:_um_um>4mo. _u_.__u=n1235 ommm83.3>onmmmo_.<U<<m___:ucam _so<2_U<_<_m=.Um_.No:Em: mmnoznmn3._<_m3_um_.23%..no_m=_m:Page 100 of 319 Page 101 of 319 Page 102 of 319 Page 103 of 319 Page 104 of 319 Page 105 of 319 Page 106 of 319 Page 107 of 319 Page 108 of 319 Page 109 of 319 Page 110 of 319 Page 111 of 319 PUD SITE OWNER 3333 S. PEARL ST.: CASEY ADRAGNA AMY ADRAGNA 2192 W. CALEY AVE. LITTLETON, CO 80120 TEL: (719) 351-4918 EMAIL: adragna84@gmail.com OWNER 3323 S. PEARL ST.: SCOTT BRANN ELIZABETH BRANN 8474 S. BRENTWOOD ST. LITTLETON, CO 80128 TEL: (303) 906-1426 EMAIL: scott580@comcast.net OWNER 3317 S. PEARL ST.: KELLEY RHODES 3317 S. PEARL ST. ENGLEWOOD, 80113 TEL: (303) 761-1816 ARCHITECT: CASEY ADRAGNA 2192 W. CALEY AVE. LITTLETON, CO 80120 TEL: (719) 351-4918 EMAIL: adragna84@gmail.com PROJECT TEAM CIVIL ENGINEER: ALTITUDE LAND CONSULTANTS, INC. 3461 RINGSBY COURT, #125 DENVER, CO 80216 TEL: (720) 427-6161 ERIC BURTZLAFF, PE eric@altitudelandco.com SURVEYOR: COLORADO ILC SERVICES PO BOX 181551 DENVER, CO 80218 TEL: (303) 668-7540 MICHAEL ROBERT SHEET INDEX 01 COVER SHEET/ DISTRICT PLAN 02 ADJACENT ZONING/ LAND USE MAP 03 SITE PLAN/ BULK PLANE DIAGRAM 04 GRADING AND DRAINAGE 05 UTILITY PLAN 06 LANDSCAPE PLAN 07 CONCEPTUAL RENDERINGS 08 CONCEPTUAL RENDERINGS ALTA SURVEY ATTACHED AFTER SHEET 08. ARCHITECTURAL CHARACTER: THE ARCHITECTURAL CHARACTER OF THIS DEVELOPMENT SHALL BE URBAN IN CHARACTER AND WILL PROVIDE FOR PEDESTRIAN SCALE ALONG THE STREET LEVEL. DESIGN SHALL INCLUDE THE FOLLOWING: 1. A MINIMUM OF TWO DIFFERENT MATERIAL PATTERNS AND COLOR CHANGES SHALL BE INCORPORATED INTO EACH FACADE (ALL SIDES) OF THE BUILDING DESIGN. 2. THE FRONT FACADE OF EACH TOWNHOME OR SINGLE FAMILY HOME SHALL HAVE A MIN. OF 30% MASONRY OR A DEFINED FRONT PORCH THAT EXTENDS THE ENTIRE WIDTH OF THE FRONT ELEVATION. 3. STUCCO, STONE, CMU, BRICK, CEMENTITIOUS AND METAL SIDING ARE PERMISSIBLE BUILDING MATERIALS. 4. PREDOMINANT ENTRIES SHALL BE CLEARLY DEFINED AND MAY CONSIST OF ELEMENTS SUCH AS: CANOPIES, OVERHANGS, PEAKED ROOFS, OR ARCHES. SUBMITTED AS PART OF THE PROPOSED PUD ARE CONCEPTUAL RENDERINGS INDICATING THE GENERAL LEVEL OF DESIGN QUALITY, FINISHES, AND MATERIALS TO BE INCORPORATED IN THE PROJECT (SEE SHEETS 8 AND 9). THE SPECIFIC DESIGN, MATERIALS, AND COLORS TO BE INCORPORATED IN THE FINAL CONSTRUCTION WILL BE DETERMINED AND SUBMITTED WITH PERMIT DRAWINGS. ANY DEVELOPMENT SHALL INCORPORATE THE AFOREMENTIONED FEATURES TO CREATE AESTHETICALLY PLEASING BUILDING THAT HAVE STRONG ARCHITECTURAL CHARACTER WITH HIGH QUALITY FINISHES THAT COMPLEMENT THE EXISTING NEIGHBORHOOD CONTEXT. MODIFICATIONS AND AMENDMENT OF PUD: ANY FUTURE DEVELOPMENT ON LOTS 40-47 SHALL COMPLY WITH THIS PUD DISTRICT PLAN AND PUD SITE PLAN. DISTRICT PLAN THE TERMS, CONDITIONS, AND ADOPTED PUD DISTRICT PLAN AND DOCUMENTS MAY BE CHANGED AND/ OR AMENDED IN WHOLE OR IN PART AS FOLLOW: 1. MINOR MODIFICATIONS (UP TO 10% DEVIATION FROM PUD STANDARDS) TO THE PUD DISTRICT PLAN: THE CITY MANAGER OR HIS DESIGNEE MAY APPROVE MINOR MODIFICATIONS IN THE LOCATION, SIZING, AND HEIGHT OF STRUCTURES OR FACILITIES IF REQUIRED BY ENGINEERING OR OTHER CIRCUMSTANCES NOT FORESEEN AT THE TIME OF THE PUD DISTRICT PLAN WAS APPROVED. 2. MAJOR MODIFICATIONS (GREATER THAN 10% DEVIATION FROM PUD STANDARDS) TO THE PUD DISTRICT PLAN: MAJOR MODIFICATIONS MAY BE MADE TO THE APPROVED PUD DISTRICT PLAN PURSUANT OF THE SAME LIMITATIONS AND REQUIREMENTS BY WHICH SUCH PLANS AND DOCUMENTS WERE ORIGINALLY APPROVED. SITE PLAN 1. MINOR MODIFICATIONS (UP TO 10% DEVIATION FROM PUD STANDARDS) TO THE PUD SITE PLAN: THE CITY, THROUGH THE DEVELOPMENT REVIEW TEAM, MAY AUTHORIZE MINOR DEVIATIONS FROM THE PUD SITE PLAN WHEN SUCH DEVIATIONS APPEAR NECESSARY IN LIGHT OF TECHNICAL OR ENGINEERING CONSIDERATIONS. MINOR DEVIATIONS SHALL NOT BE PERMITTED IF ANY OF THE FOLLOWING CIRCUMSTANCES RESULT: - A CHANGE IN THE CHARACTER OF THE DEVELOPMENT. - A CHANGE IN THE PERMITTED LAND USE. - AN INCREASE IN THE MAXIMUM HEIGHT OF ANY BUILDING. - AN INCREASE IN THE NUMBER OF DWELLING UNITS. - AN INCREASE IN LOT COVERAGE. - A REDUCTION IN THE SETBACKS FROM PROPERTY LINES. 2. MAJOR (GREATER THAN 10% DEVIATION FROM PUD STANDARDS) SITE PLAN AMENDMENTS SIMILAR TO ITEMS LISTED ABOVE: ALL PUD SITE PLANS APPROVED AND RECORDED MAY ONLY BE AMENDED PURSUANT TO THE SAME PROCEDURE AND SUBJECT TO THE SAME LIMITATIONS AND REQUIREMENTS BY WHICH SUCH PLANS WERE APPROVED. PUD DISTRICT DEVELOPMENT STANDARDS: 1. GENERAL REGULATIONS: UNLESS OTHERWISE PROVIDED FOR IN THIS PUD OR SUBSEQUENT AMENDMENTS, THE PROVISIONS, STANDARDS, REGULATIONS, AND PROCEDURES PERTINENT TO AN APPLICATION FOR THE DEVELOPMENT OF LAND WITHIN THIS PUD ZONE DISTRICT COMPLIES WITH THE R-1-C ZONE DISTRICT OF THE CITY OF ENGLEWOOD EXCEPT FOR THE ITEMS NOTED IN THE FOLLOWING SECTIONS. 3. BULK PLANE: BULK PLANE REQUIREMENTS SHALL COMPLY WITH THE CITY OF ENGLEWOOD UNIFIED DEVELOPMENT CODE FOR R-1-C ZONE DISTRICTS. SEE DIAGRAM ON SHEET 04. 4. PARKING: PARKING REQUIREMENTS SHALL EXCEED THE CITY OF ENGLEWOOD UNIFIED DEVELOPMENT CODE. EACH RESIDENTIAL DWELLING UNIT SHALL BE EQUIPPED WITH 2 OFF-STREET PARKING SPACES. 5. SIGNAGE: SIGNAGE SHALL COMPLY WITH THE CITY OF ENGLEWOOD UNIFIED DEVELOPMENT CODE FOR R-1-C ZONE DISTRICTS. 6. LANDSCAPING AND SCREENING: LANDSCAPING AND SCREENING SHALL COMPLY WITH THE CITY OF ENGLEWOOD UNIFIED DEVELOPMENT CODE SECTION 16-6-7. - SEE PRELIMINARY LANDSCAPING PLAN ON SHEET 06. 7. LIGHTING: EXTERIOR LIGHTING SHALL BE DOWNCAST, FULL CUT OFF LAMPS. 8. ALLOWED USES: ALLOWED USES SHALL COMPLY WITH THE CITY OF ENGLEWOOD UNIFIED DEVELOPMENT CODE AS IT PERTAINS TO ZONE DISTRICT R-1-C. 2. SUMMARY OF DIMENSIONAL REQUIREMENTS FOR PRINCIPAL STRUCTURES EXISTING ZONING R-1-C MIN. LOT AREA (SF) MAX FAR MAX LOT COVERAGE MIN. LOT WIDTH MAX HEIGHT (FT)FRONT SIDES REAR MINIMUM SETBACKS (FT) ONE-UNIT DWELLING 6,000 NONE 40%50 32 25 5 20 PROPOSED PEARL ST. PUD ONE-UNIT DWELLING 4,500 NONE 40%37.5 32 25 5 20 MULTI-UNIT DWELLING (MAX. UNITS BASED ON LOT AREA & LOT WIDTH 3,000 PER UNIT NONE 50%25 PER UNIT 32 25 5 25 PARKING OFF-STREET SPACES / UNIT 2 SPACES 2 SPACES SUMMARY OF DIMENSIONAL REQUIREMENTS FOR DETACHED ACCESSORY STRUCTURES USE MAX NUMBER MAX HEIGHT (FT) DETACHED GARAGE 1 PER DWELLING UNIT 16 25 3 6 FRONT SIDES REAR MAX FLOOR AREA 1,000 SF STORAGE SHED 1 10 25 3 3 150 SF OTHER ACCESSORY STRUCTURE 1 12 25 3 3 200 SF ALL OTHER ALLOWED USES 24,000 NONE 50%200 32 25 25 25 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 COVER SHEET DISTRICT PLAN SHEET 01 OF 08 VICINITY MAP- NOT TO SCALE NORTH LEGAL DESCRIPTION PARCEL: 3333 S PEARL (REC. NO. D6022863) 0.215 ACRES (9,385 SF) LOTS 40, 41 AND 42 BLOCK 3, WEST VIEW ADDITION TO ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO PARCEL: 3323 S PEARL (REC. NO. B9093887) 0.143 ACRES (6,248 SF) LOTS 43 AND 44 BLOCK 3, WEST VIEW ADDITION TO ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO PARCEL: 3317 S PEARL (REC. NO. B3070626) 0.143 ACRES (6,244 SF) LOTS 45 AND 46, BLOCK 3, WEST VIEW ADDITION TO ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO PROPERTY LOCATION THE PROPOSED PUD IS LOCATED ON S. PEARL ST. BETWEEN GIRARD AVE. TO THE SOUTH AND FLOYD AVE. TO THE NORTH. THE PROPERTY IS WITHIN ONE BLOCK NORTH OF SWEDISH AND CRAIG HOSPITALS. THE ENGLEWOOD LIGHT RAIL STATION IS ONE MILE WEST OF THE PROPOSED DEVELOPMENT. PROJECT BACKGROUND THE PROJECT IS COMPRISED OF 3 PARCELS (PARCEL ID # 1971-34-4-19-022 (3333 S. PEARL ST.), PARCEL ID #1971-34-4-19-023 (3323 S. PEARL ST.) AND PARCEL ID #1971-34-4-19-024 (3317 S. PEARL ST.)) TOTALING 21,877 SQUARE FEET, APPROXIMATELY .5022 ACRES. CURRENTLY PARCEL 1 (3333 S. PEARL)IS ZONED R-1- C AND HAS AN 800 SQUARE FOOT ALLEY HOME AND 300 SQUARE FOOT GARAGE; IT IS PROPOSED TO ALLOW THE CONSTRUCTION OF UP TO 3- TOWNHOME UNITS ON THIS PROPERTY WITH THE OPTION TO CONSTRUCT 2 SINGLE FAMILY HOMES. CURRENTLY PARCEL 2 (3323 S. PEARL) IS ZONED R-1-C AND HAS A 1,400 SQUARE FOOT HOME AND 775 SQUARE FOOT GARAGE; IT IS PROPOSED TO ALLOW THE CONSTRUCTION OF UP TO 2- TOWNHOME UNITS ON THIS PROPERTY. CURRENTLY PARCEL 3 (3317 S. PEARL) IS ZONED R-1-C AND HAS A 1,000 SQUARE FOOT HOME AND 500 SQUARE FOOT GARAGE; IT IS PROPOSED TO ALLOW THE CONSTRUCTION OF UP TO 2- TOWNHOME UNITS ON THIS PROPERTY. THE PLANNED UNIT DEVELOPMENT WILL BE PROCESSED PURSUANT TO THE APPLICABLE CITY REGULATIONS. PUD PLAN NOTES 1. THIS PROPERTY DOES NOT LIE WITHIN THE 100-YEAR FLOODPLAIN. 2. NEW UTILITIES SHALL BE UNDERGROUND. 3. ALL CONCRETE WORK DONE IN THE PUBLIC RIGHT OF WAY SHALL BE IN CONFORMANCE WITH CONSTRUCTION STANDARDS AND CONCRETE SPECIFICATIONS FOR THE CITY OF ENGLEWOOD, COLORADO. 4. THE DEVELOPER SHALL COMPLY WITH ALL APPLICABLE CITY CODES, REGULATIONS, AND STANDARDS. 5. IN THE EVENT OF A CONFLICT BETWEEN THE SPECIFIC PROVISIONS OF THIS PUD AND TITLE 16, THE SPECIFIC PROVISIONS OF THIS PUD SHALL CONTROL. PUD DEVELOPMENT SUMMARY - MARKET THE DEVELOPMENT UNDER THIS PUD IS INTENDED TO TARGET INDIVIDUALS LOOKING FOR OWNERSHIP OF NEW, HIGH QUALITY RESIDENTIAL CONSTRUCTION WITH CLOSE PROXIMITY TO SWEDISH AND CRAIG HOSPITALS AS WELL AS ALL OF THE AMENITIES OFFERED BY DOWNTOWN ENGLEWOOD. THE ANTICIPATED PRICE RANGE FOR THE INDIVIDUAL TOWNHOMES IS BETWEEN $500,000-$750,000. - COMPREHENSIVE PLAN WITHIN ENGLEWOOD'S ADOPTED 2016 COMPREHENSIVE PLAN THE PROPERTY UNDER THIS PUD IS LOCATED IN THE MEDICAL DISTRICT AND WITHIN THE MEDICAL DISTRICT THESE PROPERTIES FALL WITHIN THE RESIDENTIAL TRANSITION AREAS. ONE OF THE STATED OBJECTIVES OF THE RESIDENTIAL TRANSITION AREA IS "TO EXPLORE RESIDENTIAL REDEVELOPMENT PLANS THAT PROMOTE INFILL TOWNHOME DEVELOPMENT BETWEEN THE HOSPITALS AND SINGLE FAMILY NEIGHBORHOODS TO THE NORTH TO PROVIDE A TRANSITIONAL ZONE THAT WILL DIVERSIFY LAND USE MIX, PROVIDE OPPORTUNITIES FOR NEW HOUSING AND HOME OWNERSHIP." THIS PUD WILL IN MANY WAYS ACCOMPLISH THE STATED OBJECTIVES OF THE COMPREHENSIVE IN REGARD TO THIS AREA OF ENGLEWOOD. - RELATIONSHIP TO NEIGHBORHOOD -THE PROPOSED PUD IS CURRENTLY IN THE R-1-C ZONE DISTRICT ON THE WEST SIDE OF PEARL ST., ALTHOUGH DIRECTLY ACROSS THE STREET, THE EAST SIDE OF PEARL, IS ZONED MU-R-3-C WHICH IS MIXED USE AND HIGH DENSITY RESIDENTIAL. THE OPPOSING STREET FRONTAGE IS MADE UP OF A COMBINATION OF HIGH DENSITY RESIDENTIAL APARTMENT BUILDINGS, SINGLE FAMILY RESIDENTIAL AND DUPLEX RESIDENCES; GIVING A VERY DIVERSIFIED MIX OF HOUSING OPTIONS IN THE IMMEDIATE NEIGHBORHOOD. THEREFORE, THE ADDITION OF TOWNHOMES ON THE WEST SIDE OF PEARL WILL FURTHER CONTRIBUTE TO THE DIVERSIFIED HOUSING MIX. - THE WEST (R-1-C) SIDE OF PEARL IS MADE UP OF A COMBINATION OF SINGLE FAMILY HOMES WITH A VERY DIVERSIFIED ARCHITECTURAL CHARACTER RANGING FROM 100 YEAR OLD BUNGALOWS TO NEWER TWO-STORY HOMES. IT IS THE INTENT OF THIS PUD TO INCORPORATE MANY OF THE ARCHITECTURAL ELEMENTS OF THE EXISTING HOMES IN ORDER TO TIE INTO THE EXISTING ARCHITECTURAL CONTEXT OF THE NEIGHBORHOOD.Page 112 of 319 ZONING MU-R-3-C ZONING R-1-C ZONING M-1 ZONING MU-R-3-B ZONING R-1-C ZONING PUD-13 PROPOSED PEARL ST. PUD 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 ADJACENT ZONING SHEET 02 OF 08 NORTH SCALE: 12" = 1'-0"1 ADJACENT ZONING WITHIN 300' OF PUD Page 113 of 319 3333 S. PEARL ST. LOTS 40-42 Blk 3 WEST VIEW 9,385 SF ALLEY(16' W.)3323 S. PEARL ST. LOTS 43-44 Blk 3 WEST VIEW 6,248 SF 3317 S. PEARL ST. LOTS 45-46 Blk 3 WEST VIEW 6,244 SF 6' - 0"22' - 0"17' - 5"54' - 6"25' - 1" 24' - 11"5' - 0"+/- 25' - 0"+/- 25' - 0"+/- 25' - 0"+/- 25' - 0"+/- 25' - 0"+/- 25' - 0"+/- 25' - 0"5' - 0"5' - 0"3' - 0"3' - 0"3' - 0"3' - 0"6' - 0"22' - 0"22' - 0"50' - 0"25' - 0"3' - 0" 6' - 0"22' - 0"22' - 0"50' - 0"25' - 0" +/- 125' - 0"S. PEARL ST.(60' RIGHT-OF-WAY)BLOCK 3 EX. CONC. WALKEX. LANDSCAPELOT 40- TOWNHOME 1 BLDG FOOTPRINT +/- 1,070 SF 2-CAR GARAGE 484 SF LOT 41- TOWNHOME 2 BLDG FOOTPRINT +/- 1,070 SF LOT 42- TOWNHOME 3 BLDG FOOTPRINT +/- 1,070 SF LOT 43- TOWNHOME 4 BLDG FOOTPRINT +/- 1,070 SF LOT 44- TOWNHOME 5 BLDG FOOTPRINT +/- 1,070 SF LOT 45- TOWNHOME 6 BLDG FOOTPRINT +/- 1,070 SF LOT 46- TOWNHOME 7 BLDG FOOTPRINT +/- 1,070 SF 5' - 0"5' - 0"5' - 0"17' - 0"3' - 0"3' - 0"3' - 0"30' - 0" 2-CAR GARAGE 484 SF 2-CAR GARAGE 484 SF 2-CAR GARAGE 484 SF 2-CAR GARAGE 484 SF 2-CAR GARAGE 484 SF 2-CAR GARAGE 484 SF NEW PAVEMENT IN ALLEYEX. GRAVEL EX. GRAVEL DRAINAGE EASEMENT 3' - 0"DRAINAGE EASEMENT 6' - 0"DRAINAGE EASEMENT 6' - 0"DRAINAGE EASEMENT 3' - 0"PROPERTY LINESIDE SETBACK 5' - 0"BULK PLANE START HT. AT PROPERTY LINE17' - 0"4 5 .0 0 °MAX BLDG HT. AT SIDE SETBACK22' - 0"MAX BLDG HT. 32' - 0"MAX EXTENTS OF BUILDING ENVELOPE EXISTING BUILDING STRUCTURE NEW ALLEY PAVEMENT SITE PLAN LEGEND EX. LANDSCAPELOT 41.5-42- SINGLE FAMILY HOME BLDG FOOTPRINT +/- 1,300 SF 2-CAR GARAGE 550 SF LOT 41.5-42- SINGLE FAMILY HOME BLDG FOOTPRINT +/- 1,300 SF 2-CAR GARAGE 550 SF 125' - 0"37' - 6"37' - 6"25' - 0"6' - 0"22' - 0"22' - 0"50' - 0"5' - 0"5' - 0"5' - 0"5' - 0"6' - 3"25' - 0"6' - 3"3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 PROPOSED SITE PLAN SHEET 03 OF 08 SCALE: 1" = 10'-0"1 PROPOSED SITE PLAN NORTH SCALE: 1/4" = 1'-0"2 BULK PLAN SECTION 0 5 10 20 30 SCALE: 1" = 10'-0"4 ALTERNATE 3333 S. PEARL SINGLE FAMILY SITE PLAN Page 114 of 319 PUBLIC ALLEY(16' R.O.W.)S. PEARL STREET(60' R.O.W.)5370 5369 537 0 537053715372 53 7 2 537 1 53 7 1 5371 PUBLIC ALLEY(16' R.O.W.)S. PEARL STREET(60' R.O.W.)5370 5369 537 0 537053715372 53 7 2 537 1 53 7 1 5371 X X X X XX XXXXX X X X X X X X X X X X XX X X X X X X X X X XXXXXXXXXXXX X X X X X X X X X X X GARAGE GARAGE GARAGE GARAGE GARAGE GARAGE GARAGE 3317 S. PEARL ST. 3323 S. PEARL ST. 3333 S. PEARL ST. LOT 46 LOT 45 LOT 44 LOT 43 LOT 42 LOT 41 LOT 40 3.0' D.E.3.0' D.E.3.0' D.E.3.0' D.E.3.0' D.E.3.0' D.E.ALLEYWAY TO BE PAVED ATTIME OF CONSTRUCTIONPUBLIC ALLEY(16' R.O.W.)S. PEARL STREET(60' R.O.W.)5370 5369 537 0 537053715372 53 7 2 537 1 53 7 1 5371 TBC: 5369.32' FL: 5368.85' TBC: 5370.07' FL: 5369.64' TBC: 5370.70' FL: 5370.27' TBC: 5371.12' FL: 5370.69' TBC: 5371.72' FL: 5371.25'FL: 5372.69' FL: 5371.92' FL: 5371.67' FL: 5370.08' FL: 5372.31' FL: 5371.14' EG: 5371.90' EG: 5373.15' EG: 5370.19' FFE: 5371.65 FFE: 5371.65 FFE: 5372.30 FFE: 5372.30 FFE: 5373.30 FFE: 5373.30 FFE: 5373.30 EG: 5368.26' EG: 5369.23' EG: 5371.68' EG: 5371.70' FG: 5368.84' (3) - 6" RISERS TS: 5371.07' BS: 5369.57' 3.6% FG: 5369.02' 4.7% FG: 5369.85' FG: 5369.95' 1.9%2.6% (3) - 4" RISERS TS: 5371.33' BS: 5370.33' FG: 5370.20' FG: 5370.23'3.2%(3) - 4" RISERS TS: 5371.97' BS: 5370.97' 3.3% FG: 5370.48' FG: 5370.51'2.6% (3) - 4" RISERS TS: 5372.11' BS: 5371.11' 1.9% FG: 5370.80' FG: 5370.83' 4.3%1.7% (3) - 6" RISERS TS: 5373.20' BS: 5371.70' FG: 5371.16' FG: 5371.20' 2.3%1.7% (3) - 6" RISERS TS: 5373.14' BS: 5371.64' FG: 5371.40' FG: 5371.45' 1.4%1.7% (3) - 6" RISERS TS: 5373.20' BS: 5371.70' FG: 5372.94' FG: 5372.49' FG: 5372.41' FG: 5371.96' FG: 5371.89' FG: 5371.71' FG: 5371.61' FG: 5371.45' FG: 5371.41' FG: 5371.23' FG: 5371.13' FG: 5370.87' FG: 5370.78' FG: 5370.35' 5369 53 7 0 5371 5370 5371 5371 53715372 5372 53 7 22.5%1.4%0.6%1.0%1.9%1.3%1.3%1.2%1.4%1.5%FFE: 5373.35 FFE: 5373.35 FFE: 5372.44 FFE: 5372.16 FFE: 5372.16 FFE: 5371.68 FFE: 5371.68 5.0% 2.0% 2.0% 3.3% 2.0% 4.7% 5369 GRADING & DRAINAGE PLAN 5 05 0 5 10 20 30 ( IN FEET ) 1 inch = 10 ft. LEGEND: ALL PLANAMETRIC LINEWORK THAT IS FADED BACK SHOWN HEREIN INDICATES AN EXISTING FEATURE (IMPROVEMENT, TOPOGRAPHY, UTILITY, ETC.). ALL PLANIMETRIC TEXT THAT IS FADED BACK AND ITALICIZED SHOWN HEREIN INDICATES A CALLOUT TO AN EXISTING FEATURE. SPOT ELEVATION5280' FENCEX EXISTING CONTOUR5280 EXISTING CONCRETE N S EW 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO. WEST ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 DRAWN BY: CHECKED BY: DATE: REVISION: JMG 17-176 07.25.20173333, 3323, 3317 S. PEARL STREETPLANNED UNIT DEVELOPMENTCITY OF ENGLEWOOD,COUNTY OF ARAPAHOE, STATE OF COLORADOETB FOR CONSTRUCTION COPYRIGHT 2017 THIS DOCUMENT IS AN INSTRUMENT OF SERVICE, AND AS SUCH REMAINS THE PROPERTY OF THE ENGINEER. PERMISSION FOR USE OF THIS DOCUMENT IS LIMITED AND CAN BE EXTENDED ONLY BY WRITTEN AGREEMENT WITH ALTITUDE LAND CONSULTANTS. SHEET OF 09 3461 RINGSBY CT, SUITE 125 DENVER, CO 80216 2727 NORTH CASCADE, #160 COLORADO SPRINGS, CO 80907 720.413.9691 INFO@ALTITUDELANDCO.COM WWW.ALTITUDELANDCO.COM CIVIL|SURVEY|PLANNING|LANDSCAPE LAND CONSULTANTS I N C LTITUDE NO. DATE BY 3333, 3323, 3317 S. PEARL STREET - PLANNED UNIT DEVELOPMENT GENERAL NOTES: 1.ALL TOPOGRAPHIC AND PLANIMETRIC INFORMATION CONTAINED HEREIN WAS GATHERED IN THE FIELD ON JULY 7TH, 2017 BY COLORADO ILC SERVICES. 2.UTILITIES SHOWN HEREON ARE BASED ON GRAPHICAL EVIDENCE, UTILITY MAPS FROM THE GOVERNING JURISDICTIONS AND SURVEYED EVIDENCE IN THE FIELD. 3.SITE ADDRESS IS: 3333, 3323, 3317 S. PEARL STREET, ENGLEWOOD, CO 80113 4.SITE BENCHMARK IS: NGS BENCHMARK "W 409" LOCATED IN THE SOUTHEAST CORNER OF THE INTERSECTION OF EAST HAMPDEN AVENUE AND SOUTH DOWNING STREET, ASSUMED TO HAVE AN ELEVATION OF 5381.07 FEET (NAVD 83). 5.CONTRACTOR SHALL SLOPE ALL FINED GRADES DOWN AWAY FROM ALL BUILDING DOOR LOCATIONS, AS SHOWN. DOWNSPOUT NOTES: 1.ALL DISCHARGE POINTS FOR DOWNSPOUT LINES MUST BE AT LEAST 3 FEET AWAY FROM ADJACENT PROPERTIES AND PUBLIC SIDEWALKS. IF EXTENDERS ON THE DOWNSPOUTS OR SUMP LINES DO NOT DISCHARGE TO A FOUNDATION SPLASH BLOCK, EXTENDERS MUST BE AT LEAST 2 FEET FROM THE BUILDING FOUNDATION. FG: FINISHED GRADE EG: EXISTING GRADE FL: FLOW LINE TC: TOP OF CURB BC: BOTTOM OF CURB BS: BOTTOM OF STEP TS: TOP OF STEP GB: GRADE BREAK GS: GROUND SHOT TW: TOP OF WALL BW: BOTTOM OF WALL DS: DOWNSPOUT FFE: FINISHED FLOOR ELEVATION HP: HIGH POINT ABBREVIATION LEGEND DRAINAGE ARROW 4 04 OF 08 Page 115 of 319 3333 S. PEARL ST. LOTS 40-42 Blk 3 WEST VIEW 9,385 SF ALLEY(16' W.)3323 S. PEARL ST. LOTS 43-44 Blk 3 WEST VIEW 6,248 SF 3317 S. PEARL ST. LOTS 45-46 Blk 3 WEST VIEW 6,244 SF S. PEARL ST.(60' RIGHT-OF-WAY)LOT 40 LOT 41 LOT 42 LOT 43 LOT 44 LOT 45 LOT 46 WWWWWWWWWWWWWWWWWWWAPPROX. LOCATION EX 4" WATER MAIN WWWW WWWW WWWW WWWW WWWW WWWW WWWW EX WATER LINE TO REMAIN EX WATER LINE TO REMAIN EX WATER LINE TO REMAIN NEW 3/4" WATER SERVICE NEW 3/4" WATER SERVICE NEW 3/4" WATER SERVICE NEW 3/4" WATER SERVICE EX SIDEWALK EX CURB & GUTTER S S S S S S S S S S S S S S S S S S S EX 8" SAN. MAIN S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S S 4" PVC SAN. SERVICE 4" PVC SAN. SERVICE 4" PVC SAN. SERVICE 4" PVC SAN. SERVICE 4" PVC SAN. SERVICEOHUOHUOHUOHUOHUOHUOHUOHUOHUOHUOHUOHUOHUEX OVERHEAD ELECTRIC LINES NEW PAVEMENT IN ALLEYDRAINAGE EASEMENT 3' - 0"DRAINAGE EASEMENT 6' - 0"DRAINAGE EASEMENT 6' - 0"DRAINAGE EASEMENT 3' - 0"LEGEND EXISTING WATER LINE EXISTING SAN SEWER LINE EXISTING OVERHEAD ELEC EXISTING BUILDING PROPOSED WATER LINE PROPOSED SAN SEWER LINE W W S S OHU OHU W W S S 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 UTILITY PLAN SHEET 05 OF 08 SCALE: 1" = 10'-0"1 UTILITY PLAN NORTH 0 5 10 20 30 Page 116 of 319 3333 S. PEARL ST. LOTS 40-42 Blk 3 WEST VIEW 9,385 SF ALLEY(16' W.)3323 S. PEARL ST. LOTS 43-44 Blk 3 WEST VIEW 6,248 SF 3317 S. PEARL ST. LOTS 45-46 Blk 3 WEST VIEW 6,244 SF S. PEARL ST.(60' RIGHT-OF-WAY)LOT 40 LOT 41 LOT 42 LOT 43 LOT 44 LOT 45 LOT 46 GARAGE TOWNHOME TOWNHOME TOWNHOME TOWNHOME TOWNHOME TOWNHOME TOWNHOME GARAGE GARAGE GARAGE GARAGE GARAGE GARAGE TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF TURF REAR PATIO REAR PATIO REAR PATIO REAR PATIO REAR PATIO REAR PATIO REAR PATIO ROCK MULCH ROCK MULCH ROCK MULCH ROCK MULCH ROCK MULCH ROCK MULCH ROCK MULCH ROCK MULCH PRIVACY FENCE PRIVACY FENCE PRIVACY FENCE PRIVACY FENCE PRIVACY WALL PRIVACY WALL PRIVACY WALL PRIVACY WALL EX CONC. SIDEWALKEX TREE TO REMAIN EX TREE TO REMAIN LANDSCAPE LEGEND 6' PRIVACY FENCE VARIOUS TREE SPECIES VARIOUS SHRUB SPECIES SOD ROCK MULCH SITE CALCULATIONS DECIDUOUS TREES BOTANICAL NAME / COMMON NAME Acer freemanii `Autumn Blaze` / Autumn Blaze Maple Existing Tree / Existing Tree Gleditsia triacanthos `Imperial` / Imperial Honeylocust Koelreuteria paniculata / Golden Rain Tree Tilia americana `Redmond` / Redmond American Linden EVERGREEN TREES BOTANICAL NAME / COMMON NAME Juniperus scopulorum `Skyrocket` / Skyrocket Juniper Pinus aristata `Sherwood Compacta` / Dwarf Bristlecone Pine ORNAMENTAL TREES BOTANICAL NAME / COMMON NAME Acer ginnala compactum / Compact Amur Maple Acer tataricum / Tatarian Maple Crataegus x mordenensis `Toba` / Toba Hawthorn Malus x `Radiant` / Radiant Crab Apple Malus x `Spring Snow` / Spring Snow Crab Apple Prunus virginiana `Shubert` / Canada Red Chokecherry ORNAMENTAL GRASSES BOTANICAL NAME / COMMON NAME Calamagrostis x acutiflora `Karl Foerster` / Feather Reed Grass Festuca glauca `Elijah Blue` / Blue Fescue Helictotrichon sempervirens / Blue Oat Grass Miscanthus sinensis `Morning Light` / Morning Light Silver Grass Miscanthus sinensis `Variegatus` / Variegated Japanese Silver Grass Pennisetum alopecuroides / Fountain Grass Pennisetum alopecuroides `Hameln` / Dwarf Fountain Grass Schizachyrium scoparium / Little Bluestem Grass DECIDUOUS SHRUBS BOTANICAL NAME / COMMON NAME Berberis thunbergii `Atropurpurea Nana` / Dwarf Redleaf Japanses Barberry Caryopteris x clandonensis `Blue Mist` / Blue Mist Shrub Cercis canadensis / Eastern Redbud Multi-trunk Cornus sericea `Kelseyi` / Kelseyi Dogwood Forsythia x intermedia `Arnold`s Dwarf` / Dwarf Forsythia Genista tinctoria `Plena` / Woadwaxen Ligustrum vulgare `Lodense` / Lodense Privet Potentilla fruticosa `Gold Drop` / Gold Drop Potentilla Prunus besseyi `Pawnee Buttes` / Sand Cherry Rhus aromatica `Gro-Low` / Gro-Low Fragrant Sumac Ribes alpinum / Alpine Currant Spiraea x bumalda `Anthony Waterer` / Anthony Waterer Spiraea Spiraea x bumalda `Limemound` TM / Limeound Spirea Syringa meyeri `Palibin` / Dwarf Korean Lilac EVERGREEN SHRUBS BOTANICAL NAME / COMMON NAME Arctostaphylos x coloradoensis / Manzanita Arctostaphylos x coloradoensis `Panchito` / Panchito Manzanita Buxus sinica insularis `Wintergreen` / Wintergreen Korean Littleleaf Boxwood Cotoneaster dammeri `Coral Beauty` / Bearberry Cotoneaster Cotoneaster horizontalis perpusillus / Perpusillus Rock Spray Cotoneaster Euonymus fortunei `Colorata` / Purple-leaf Winter Creeper Juniperus horizontalis plumosa `Youngstown` / Creeping Juniper Juniperus horizontalis `Blue Chip` / Blue Chip Juniper Juniperus sabina `Arcadia` / Arcadia Juniper Juniperus sabina `Buffalo` / Buffalo Juniper Pinus mugo `Mops` / Mugo Pine SUGGESTED PLAN PALETTE 1. FINAL CONSTRUCTION DOCUMENTS SUBMITTED TO THE CITY SHALL CONFORM TO THE REQUIREMENTS OUTLINED WITHIN THIS PUD SUBMITTAL. 2. LANDSCAPE PLANS DEPICTED ARE SCHEMATIC IN NATURE AND ARE SUBJECT TO MODIFICATIONS. 3. THE LOCATION OF LANDSCAPE PLANTINGS MAY BE ALTERED TO PROVIDE ADEQUATE CLEARANCE FROM THE FINAL LOCATION OF UNDERGROUND UTILITIES. THE BASE OF DECIDUOUS TREES SHALL BE PLANTED NO CLOSER THAN 5' FROM WET UTILITIES. THE BASE OF EVERGREEN TREES SHALL BE PLANTED NO CLOSER THAN 10' FROM ALL WET UTILITIES UNLESS OTHERWISE DIRECTED BY THE CITY 4. GRASS AREAS DESIGNATED AS IRRIGATED TURF SHALL BE SEEDED OR SODDED WITH A DROUGHT TOLERANT GRASS MIXTURE. 5. THE SIZE OF DECIDUOUS TREES SHALL BE A MINIMUM OF 2 1/2" CALIPER AND THE SIZE OF EVERGREEN TREES SHALL BE A MINIMUM OF 6'-8' IN HEIGHT. 6. THE SIZE OF DECIDUOUS AND EVERGREEN SHRUBS SHALL BE A MINIMUM OF 5 GALLONS. 7. THE SIZE OF ORNAMENTAL GRASSES AND PERENNIALS SHALL BE A MINIMUM OF 1 GALLON. 8. THE QUANTITY AND LOCATION OF LANDSCAPE AND HARDSCAPE ELEMENTS DEPICTED MAY BE ALTERED WITHIN THE CONSTRUCTION DOCUMENTS, WITH THE INTENT OF RETAINING APPROXIMATE RLA AND LIVING LANDSCAPE TOTALS. 9. WHENEVER POSSIBLE, MECHANICAL DEVICES SHALL BE SCREENED WITH LANDSCAPE MATERIAL. 10. ALL LANDSCAPE IMPROVEMENTS SHALL BE DESIGNED AND INSTALLED WITH THE INTENT TO PRESERVE THE PEDESTRIAN EXPERIENCE WHILE ENSURING PUBLIC SAFETY AND MAINTAINING A HIGH AESTHETIC QUALITY WITHIN THE SITE. 11. PLANT DIVERSITY SHOULD BE CONSIDERED WHEN SELECTING STREET TREES. THE MAXIMUM PERCENTAGE OF ANY ONE SHRUB OR TREE SPECIES ON SITE SHOULD NOT EXCEED 33%. 12. EACH LOT'S LANDSCAPE SHALL BE IRRIGATED WITH AN AUTOMATIC SYSTEM USING THEIR OWN INDEPENDENT DOMESTIC TAP. GENERAL NOTES: 1. THE REQUIRED LANDSCAPE AREA (OR RLA) SHALL BE CALCULATED FROM THE AGGREGATE OF THE TOTAL SITE AREA AND NOT FROM INDIVIDUAL LOTS. 2. PER TABLE 16-6-7.3, A MINIMUM OF 40% OF THE TOTAL SITE AREA SHALL BE R.L.A. 3. A MINIMUM OF 70% OF THE SQUARE FOOTAGE OF R.L.A. SHALL BE LIVING LANDSCAPE. 4. A MINIMUM OF ONE TREE PER EVERY 625 SQUARE FEET OF REQUIRED LANDSCAPED AREA SHALL BE REQUIRED. 5. A MINIMUM OF 50% OF TREE REQUIREMENTS SHALL BE PLANTED BETWEEN THE PRINCIPAL STRUCTURE AND CURB. 6. WHEN THE REQUIRED LANDSCAPE AREA IS LESS THAN ONE THOUSAND TWO-HUNDRED FIFTY (1,250) SQ. FT. A MINIMUM OF TWO TREES SHALL BE REQUIRED. 7. A MINIMUM OF ONE SHRUB PER 100 SQUARE FEET OF LANDSCAPED AREA IS REQUIRED. A MINIMUM OF 30% OF SHRUB REQUIREMENTS SHALL BE PLANTED BETWEEN THE PRINCIPAL STRUCTURE AND CURB. 8. A LOW WATER PLANT PALETTE IS PROPOSED. ADDITIONAL PLANTS MAY BE PROPOSED IN SUBSEQUENT PROCESSES. 9. A DROUGHT TOLERANT PLANT PALETTE HAS BEEN SUGGESTED. ADDITIONAL PLANTS MAY BE PROPOSED IN SUBSEQUENT PROCESS. 10. A MINIMUM OF 1 STREET/CANOPY TREE WILL BE PLANTED WITHIN THE STREET-SCAPE AS PART OF THE TRT (EXCEPTION TO LOT 5-DUE TO SITE SIZE CONSTRAINTS). REMAINING TRT CAN BE FULFILLED BY ORNAMENTAL OR EVERGREEN TREES. PLANTING STANDARDS: 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 LANDSCAPING PLAN SHEET 06 OF 08 SCALE: 1" = 10'-0"1 LANDSCAPE PLAN NORTH 0 5 10 20 30 Page 117 of 319 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 CONCEPTUAL RENDERING SHEET 07 OF 08 3333 S. PEARL ST. − 3 TOWNHOMES 3323 S. PEARL ST. − 2 TOWNHOMES 3317 S. PEARL ST. − 2 TOWNHOMES Page 118 of 319 3333, 3323, 3317 S. PEARL STREET CITY OF ENGLEWOOD, COUNTY OF ARAPAHOE, STATE OF COLORADO WEST VIEW ADDITION TO ENGLEWOOD, LOTS 40-46, BLOCK 3 PEARL ST. PUDDATE: 3333, 3323, 3317 S. PEARL STREET PLANNED UNIT DEVELOPMENT 3333, 3323, 3317 S. PEARL STREET- PLANNED UNIT DEVELOPMENT PLANNED UNIT DEVELOPMENT INITIAL PUD SUBMITTAL: 07-28-17 FINAL PUD SUBMITTAL: 08-24-17 CONCEPTUAL RENDERING SHEET 08 OF 083333 S. PEARL ST. − 3 TOWNHOMES 3323 S. PEARL ST. − 2 TOWNHOMES 3317 S. PEARL ST. − 2 TOWNHOMES Page 119 of 319 Page 120 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Stephanie Carlile DEPARTMENT: City Clerk's Office DATE: October 16, 2017 SUBJECT: Amending the Code regarding the Local Licensing Authority for liquor and marijuana DESCRIPTION: Amending the Code regarding the Local Licensing Authority for liquor and marijuana RECOMMENDATION: Staff recommends Council approve a Bill for an Ordinance amending the Englewood Municipal Code 2000 to establish a Hearing Officer as the Englewood Local Liquor and Marijuana Licensing Authority. PREVIOUS COUNCIL ACTION: Staff presented an overview of the Hearing Officer concept including best practices from other front range cities at the December 12, 2016 Study Session. Council directed Staff to glean more information on the process, procedures and duties of a Hearing Officer to serve as the local licensing authority. Staff presented additional information and received consensus direction from Council at the February 13, 2017 Study Session to draft and bring forth an Ordinance establishing a Hearing Officer as the Englewood Local Liquor and Marijuana Licensing Authority. SUMMARY: Due to changes in State law and increased demand, the Liquor and Marijuana Licensing Authority requires a certain level of expertise regarding administrative law procedure. The use of a Hearing Officer instead of an Authority would ensure a level of expertise with law procedure, promote consistency during the hearing process and keep a level of impartiality for new licenses and violations. A Hearing Officer with experience in interpreting and applying complex laws, would result in less frustration for our citizens and ensure sound decisions. A Hearing Officer is more efficient, streamlines the licensing process and provides better customer service. Many municipalities in Colorado have transitioned to a Hearing Officer including Aurora, Denver, Golden, Greeley, Lakewood, Telluride, Centennial, Commerce City, and Castle Rock. Page 121 of 319 ANALYSIS: Staff recommends a qualification based selection process to chose a hearing officer. Staff would solicit qualifications from attorneys to serve as the Hearing Officer. Staff will provide Council with the recommended candidate for selection and appointment by Resolution at the January 2, 2018 Regular City Council meeting. The Resolution will also establish compensation and, at the discretion of Council, appoint an alternate Hearing Officer who may serve when the appointed Hearing Officer is unavailable. Staff recommends that the licensing approval process proceed as follows: The following would be approved by a Hearing Officer: •New Liquor and Marijuana License Applications •Transfer of Ownership Applications (upon Staff referral) •Special Event Permits (if protested) •Show Cause Hearings •Change of Location For efficiency, Staff recommends approving several liquor and marijuana items administratively: •Renewals •Manager Registrations •Change in Corporate Structure/Name Change •Temporary Permits •Modification of Premises •Transfer of Ownership Applications •Special Event Permits (not protested) [Note: We are no longer required to seek State approval on Special Event Permits, we just keep the State apprised of any that we issue.] FINANCIAL IMPLICATIONS: We are estimating a average monthly expenditure of $400.00 for the services of the Hearing Officer. Council will formally establish the compensation of the Hearing Officer. Page 122 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 67 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER _______________ A BILL FOR AN ORDINANCE AMENDING TITLE 2, CHAPTER 6, SECTION 1, AND TITLE 5, SECTIONS 5-3A-2, 5-3A-3, 5-3D-2, 5-3D-3, AND 5-3E-2 OF THE ENGLEWOOD MUNICIPAL CODE 2000 ALL PERTAINING TO THE ENGLEWOOD LOCAL LIQUOR AND MARIJUANA LICENSING AUTHORITY. WHEREAS, Amendment to the Colorado Constitution and subsequent legislation resulted in the City of Englewood approving a method for licensure of Medical Marijuana under the City’s previously established local licensing authority; WHEREAS, Approval by the electors of the City of Englewood of the licensure of Retail Marijuana resulted in the City of Englewood approving a method for licensure of Retail Marijuana under the City’s previously established local licensing authority; WHEREAS, Licensure of all types of Alcoholic Beverage, Medical Marijuana, and Retail Marijuana has, over time, become vested in the City’s local licensing authority; WHEREAS, It has become necessary to establish consistency in terminology across all sections of the Englewood Municipal Code utilizing the local licensing authority, and to designate such authority as the Englewood Liquor and Marijuana Licensing Authority; and WHEREAS, The complexity of application of State rules and regulations associated with alcoholic beverage licensing and marijuana licensing necessitates changing the Local Liquor and Marijuana Licensing Authority to a position held by a Hearing Officer. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, AS FOLLOWS: Section 1. The City Council of the City of Englewood, Colorado hereby authorizes amending Title 2 of the Englewood Municipal Code 2000 as follows: Page 123 of 319 2 Amending Title 2, Section 2-6-1 of the Englewood Municipal Code Chapter 6 – ENGLEWOOD LOCAL LIQUOR, MEDICAL MARIJUANA, AND RETAIL MARIJUANA LICENSING AUTHORITY 2-6-1: Licensing Authority Established. A. There is hereby established a Local Licensing Authority, which shall have and is vested with the authority to grant or refuse licenses for the sale at retail of malt, vinous or spirituous liquors and fermented malt beverages, as provided by law, to suspend or revoke such licenses for cause in the manner provided by law. Such authority shall have all the powers of the Local Licensing Authority as set forth in Articles 46, 47 and 48 of Title 12, C.R.S. 1973. See Title 5, Chapter 3, Article A of this Municipal Code for the organization, powers, functions and duties of the Local Licensing Authority. A. Englewood Local Liquor and Marijuana Licensing Authority. 1. Establishment. There is hereby established an Englewood Local Liquor and Marijuana Licensing Authority (“Local Licensing Authority” or “Authority”), which is vested with the authority to grant or refuse permits and licenses, to conduct investigations as are required by law, and to suspend or revoke such licenses for cause in the manner provided by law. Such Authority shall have all the powers of the Local Licensing Authority, as set forth in Articles 43.3, 43.4, 46, 47 and 48 of Title 12, C.R.S., and as otherwise granted to it in this Title 5. 2. Hearing Officer. The Local Licensing Authority shall consist of a sole Hearing Officer who shall be selected following a standard rfq process, and in conformance with the Purchasing Policies & Procedures of the City, and shall serve at the pleasure of the City Council. The Hearing Officer shall be annually appointed/reappointed by the City Council by resolution and may be removed with or without cause by a majority vote of the City Council. The City Council shall establish compensation for the Hearing Officer. The City Council may, in its discretion, appoint an alternate Hearing Officer who may serve when the appointed Hearing Officer is unavailable or has a conflict with a pending matter. The term "Hearing Officer" shall be synonymous with "Local Licensing Authority" as used throughout this section 3. Qualifications of Hearing Officer. The Hearing Officer shall be an individual licensed to practice law in the State of Colorado, with sufficient knowledge and expertise to apply and enforce the Colorado Beer Code (C.R.S. 12-46-101, et seq.), Colorado Liquor Code (C.R.S. 12-47-101, et seq.), Special Events Code (C.R.S. 12-48-101, et seq.), Medical Marijuana Code (C.R.S. 12-43.3-101, et seq.), Retail Marijuana Code (C.R.S. 12-43.4-101, et seq.), and the equivalent sections of the Englewood Municipal Code regulating the licensing of liquor or marijuana establishments in the City of Englewood, Colorado. The Hearing Officer shall not hold any other City of Englewood office, appointment or position. The Hearing Officer shall not have any financial interest in the operation of any business located or operating in the City of Englewood holding a license pursuant to any of the Codes listed within this paragraph. Page 124 of 319 3 4. Rules of procedure; conduct of hearings. In conformance with applicable statutes and the Englewood Municipal Code, the Hearing Officer serving as the Local Licensing Authority shall have the power to decide matters brought before it following a public hearing. Public hearings shall be held in in accordance with the procedural rules and regulations for hearings as set forth in Title 1, Chapter 10, and/or as adopted by the Local Licensing Authority. The Authority may also adopt rules of procedure and regulations concerning the application and renewal processes. All hearings before the Local Licensing Authority shall be public. 5. Meetings. The Local Licensing Authority shall hold a regular meeting once each calendar month, unless there is no business to conduct. The Local Licensing Authority may call special meetings after consultation with the City Clerk or the City Clerk's designee. Notification of the public of such special meetings shall be completed in the same manner as the regular meetings of the Authority. The purpose of meetings shall be to conduct public hearings regarding licensure in conformance with applicable provisions of the Englewood Municipal Code. 6. Subpoena power and violations. The Local Licensing Authority shall have the power to administer oaths and issue subpoenas to require the presence of persons and the production of documents, data compilations and other evidence at any hearing before the authority. A subpoena shall be served in the same manner as a subpoena issued by the municipal court of the City, in accordance with 1-10-3 of the EMC. It shall be unlawful for any person to fail to comply with any subpoena or order to produce documents, data compilations or other evidence issued by the authority. The municipal court shall enforce the subpoenas of the Authority and, upon good cause shown, shall enter orders compelling witnesses to attend and testify or produce documents, data compilations or other evidence, and shall impose penalties or punishment for contempt in case of failure to comply with such orders. 7. Investigators. Such person or persons as the City Manager shall designate shall serve as investigators or perform investigative duties on behalf of the Local Licensing Authority. B. There is hereby established a Local Licensing Authority to issue only the following Medical Marijuana Licenses upon payment of a fee and compliance with all Local Licensing requirements to be determined by the Local Licensing Authority as set forth in Article 43.3 of Title 12 C.R.S.: 1. A Medical Marijuana Center License; 2. A Medical Marijuana Optional Premises Cultivation Operation License; 3. A Medical Marijuana-Infused Products Manufacturer License. B. The Local Licensing Authority is vested with the authority to grant or refuse licenses for the sale at retail of malt, vinous or spirituous liquors and fermented malt beverages, as provided by law, and to suspend or revoke such licenses for cause in the manner provided by law. Such authority shall have all the powers of the Local Licensing Authority as set forth in Articles 46, 47 and 48 of Title 12, C.R.S. Page 125 of 319 4 C. The Local Licensing Authority is vested with the authority to issue only the following Medical and Retail Marijuana Licenses upon payment of a fee and compliance with all Local Licensing requirements to be determined by the Local Licensing Authority as set forth in Article 43.3 and 43.4 of Title 12 C.R.S.: 1. A Medical Marijuana Center License; 2. A Medical Marijuana Optional Premises Cultivation Operation License; 3. A Medical Marijuana-Infused Products Manufacturer License; 4. A Retail Marijuana Store License. Section 2. The City Council of the City of Englewood, Colorado hereby authorizes amending Title 5 of the Englewood Municipal Code 2000 as follows: Amending Title 5, Section 5-3A-2 of the Englewood Municipal Code 5-3A-2: Definitions. Certain terms and expressions used herein shall have the following meanings. All other words and phrases used in this article shall have the meanings attached by the Colorado Statutes regulating the sale of liquor and fermented malt beverages, or if not otherwise defined by law, are used in their common, ordinary and accepted sense and meaning. Applicant: A. If aAn individual, that person making an application for a license under this Code; B. If a partnership, All partners of a partnership which is making application for a license under this Code; or C. If a corporation, Any officer, director, manager or any stockholder therein of a corporation making application for a license under this Code. Authority or Local Licensing Authority: The local licensing authority of the City Englewood Local Liquor and Marijuana Licensing Authority. Investigator: The licensing investigator as set forth in Section 5-3A-3G of this article Section 2-6-1(A)(7) of the Englewood Municipal Code. Manager: That person or those persons who manage, direct, supervise, oversee and administer the acts, transactions and acts of servants or the establishments governed by this Article. Amending Title 5, Section 5-3A-3 of the Englewood Municipal Code 5-3A-3: Englewood Local Liquor and Marijuana Licensing Authority Established. A. Establishment. Vesting of Authority. There is hereby established an Englewood Local Liquor and Marijuana Licensing Authority (“Local Licensing Authority” or “Authority”), which is vested with the authority to grant or refuse permits and licenses for the sale at retail of malt, Page 126 of 319 5 vinous or spirituous liquors and fermented malt beverages, to conduct investigations as are required by law, and to suspend or revoke such licenses for cause in the manner provided by law. Such Authority shall have all the powers of the Local Licensing Authority, as set forth in Articles 46, 47 and 48 of Title 12, C.R.S. 1973. B. Said authority shall consist of five (5) qualified electors of the City who shall be appointed by the City Council. Of those initially appointed, two (2) shall be for a term of three (3) years, two (2) for a term of two (2) years, and one (1) for a one year term. Thereafter, appointments hall be for a three-year term. No person shall serve as a member of the Local Licensing Authority who shall have any interest in the operation of a liquor establishment or in one serving fermented malt beverages or who has a member of his or her immediate family who has such an interest. C. Any member of the Licensing Authority may be removed with or without cause by five (5) concurring votes of the City Council. Any vacancy occurring on the Licensing Authority shall be filled for the unexpired term by the City Council. D. The authority shall annually elect a chairman from its number who shall preside over all hearings and proceedings of the authority. The chairman may designate a member of the authority to assume his duties in his absence. A quorum shall consist of three (3) members, and a decision of a majority of the members of the authority shall control. Any absent member may join in a decision of the authority after he has considered the evidence adduced in any hearings conducted during his absence. All decisions are final, subject only to appeal to a court of competent jurisdiction. E. Members of the authority shall serve without compensation, but shall be reimbursed for any necessary expenditures incurred in the performance of their duties. F. The City Clerk shall receive all applications for licenses, and shall issue all licenses granted by the authority, upon receipt of such license fees and taxes as are required by law and this Code. The City Clerk shall serve as the official secretary of the authority and shall designate a person or persons to provide the necessary secretarial and report services for the authority. The City Clerk or designee shall attend the meetings of the authority. All public notice shall be made by publication on the City’s official website, or in a newspaper designated by City Council as the City’s official newspaper and by the posting of signs, as required by the Colorado Liquor Code, shall be made by the City Clerk. G. Such person or persons as the City Manager shall designate shall serve as investigators or perform investigative duties on behalf of the Local Licensing Authority. B. Delegation of authority to City Clerk. The City Clerk is authorized to act as the Local Licensing Authority for the following Colorado Liquor Code and Colorado Beer Code licensing functions: 1. Processing and issuance of special events permits pursuant to Article 48 of Title 12, C.R.S., provided that there are no parties filing a written objection to said permit. Page 127 of 319 6 2. Annual Colorado Liquor Code and Colorado Beer Code license renewals, provided that the licensee has not violated any provisions of the Colorado Liquor or Beer Codes and associated regulations during the preceding year. 3. Changes in shareholders, officers, directors or trade names of a licensee, or registration and/or changes in on-site manager, provided that any investigation conducted by the City does not reveal information that may reasonably form the basis of a determination that the applicant is not qualified to hold the respective license. 4. The issuance of temporary permits pursuant to and in compliance with the provisions of C.R.S. 12-47-302, and C.R.S. 12-47-303. A temporary permit fee shall be charged in conjunction with the issuance of each temporary permit. 5. Request to Change, Alter or Modify the Premises as set forth in E.M.C. 5-3A- 8. 6. Tasting permits issued in accordance with C.R.S. 12-47-301(10) and applicable provisions of the Englewood Municipal Code. 7. Transfer of ownership. The City Clerk may refer any licensing decision authorized under this section to the Local Licensing Authority if, in the Clerk's discretion, the matter should be presented to the Local Licensing Authority. C. Duties of the City Clerk. The City Clerk shall receive all applications for licenses, and shall issue all licenses granted by the Authority, upon receipt of such license fees and taxes as are required by law and this Code. The City Clerk shall serve as the official secretary of the Local Licensing Authority and shall designate a person or persons to provide the necessary secretarial and reporting services for the Local Licensing Authority. The City Clerk or designee shall attend the meetings of the Local Licensing Authority. All public notice shall be made by publication on the City's official website, or in a newspaper designated by City Council as the City's official newspaper. All signs required to be posted by the Colorado Liquor Code, shall be made by the City Clerk. Amending Title 5, Section 5-3D-2 of the Englewood Municipal Code 5-3D-2: - Powers and Duties of the Local Licensing Authority. A. Vesting of Authority. The Local Licensing Authority, as established in E.M.C. 2-6-1, shall grant or refuse local licenses for the cultivation, manufacture, distribution, and sale of Medical Marijuana as provided by law; suspend, fine, restrict, or revoke such licenses upon a violation of this Title, or a rule promulgated pursuant to this Title; and may impose any penalty authorized by this Title or any rule promulgated pursuant to this Title. The Local Licensing Authority may take action with respect to a registration or a license pursuant to this Title, and in accordance with the procedures established pursuant to this Title. B. Rules and Determinations. The Local Licensing Authority shall promulgate such rules and make such special rulings and findings as necessary for the proper regulation and control of Page 128 of 319 7 the cultivation, manufacture, distribution, and sale of Medical Marijuana and for the enforcement of this Chapter. C. Compliance with C.R.S. 12-43.3. The Local Licensing Authority hereby adopts shall comply with and conform to the minimum licensing requirements of Article 43.3 of Title 12 C.R.S. when issuing a License. D. Additional licensing standards. In addition to all other standards applicable to the issuance of licenses under this Code, the Local Licensing Authority hereby adopts shall comply with and conform to the following additional standards for the issuance of Medical Marijuana Center, Medical Marijuana Optional Premises Cultivation Operation, or Medical Marijuana-Infused Products Manufacturer Licenses consistent with the intent of Article 43.3 of Title 12 C.R.S. and this Code, including as follows: 1. Distance restrictions between premises in or out of City limits for which Local Licenses are issued; shall be as follows: (a) If the building in which Medical Marijuana is to be cultivated, manufactured or sold is located within two thousand feet (2,000') of a school, an alcohol or drug treatment facility, or the principal campus of a college, university, seminary, or a residential child care facility or within two thousand five hundred feet (2,500') of an existing licensed Medical Marijuana Center, Medical Marijuana-Infused Products Manufacturer or Medical Marijuana Optional Premises Cultivation Operation. The provisions of this Section shall not affect the renewal or re-issuance of a license once granted or apply to licensed premises located or to be located on land owned by a municipality; nor shall the provisions of the Section apply to existing licensed premises on land owned by the State, or apply to a license in effect and actively doing business before said principal campus was constructed. (b) The distances referred to in this Title are to be computed by direct measurement from the nearest property line of the land used for a school or campus to the nearest portion of the building in which Medical Marijuana is to be sold, cultivated or infused, using a route of direct pedestrian access. (c) After April 20, 2015, Medical Marijuana Licensed Premises shall be limited to the following locations but shall otherwise be exempt from the distance limitations of this Chapter: • 4695 South Windermere Street, Units A & B • 4332 South Broadway • 11 West Hampden Avenue, Suite 102 • 5005 South Federal Boulevard 2. Reasonable restrictions on the size of an applicant's Licensed Premises shall be as follows: (a) All Medical Marijuana Optional Premises Cultivation Operations shall not exceed five thousand (5,000) square feet. Page 129 of 319 8 (b) Restrictions on the size of licensed Medical Marijuana premises shall be reasonable based upon the specific location, site, and premises. 3. Any other requirements necessary to ensure the control of the premises and the ease of enforcement of the terms and conditions of the License, including the following: (a) Any cultivation or manufacture of Medical Marijuana within a Multi-Tenant building shall have a heating, ventilation and air conditioning system separate from the rest of the building. Amending Title 5, Section 5-3D-3 of the Englewood Municipal Code 5-3D-3: Definitions. Any word or term used that is defined in Article XVIII, Section 14 (1)(f) of the Colorado Constitution; in § 25-1.5-101 et seq. C.R.S. or in the Colorado Medical Marijuana Code, § 12- 43.3-101 et seq. C.R.S. shall have the same meaning that is ascribed to such word or term in those Constitutional provisions or C.R.S. sections unless the definition is amended by this section. Direct Measurement: means a straight line from the nearest property line of the school or campus to the nearest portion of the building used for medical marijuana. Good Cause: for purposes of refusing or denying a license renewal, reinstatement, or initial license issuance means: 1. The licensee or applicant has violated, does not meet, or has failed to comply with any of the terms, conditions, or provisions of Article 43.3 of Title 12 C.R.S., and rules promulgated pursuant to this Title, or any supplemental local law, rules, or regulations; 2. The licensee or applicant has failed to comply with any special terms or conditions that were placed on its license pursuant to an order of the State or Local Licensing Authority; 3. The licensed premises have been operated in a manner that adversely affects the public health, welfare or the safety of the immediate neighborhood in which the establishment is located. Evidence to support such a finding may include: a. A continuing pattern of offenses against the public peace, as defined in Title 7 of this Code. b. A continuing pattern of drug-related criminal conduct within the premises or in the immediate area. c. A continuing pattern of criminal conduct directly related to or arising from the facility. 4. The licensed premises will impair the use or development of adjacent conforming properties or alter the essential character of the neighborhood. Hearing Officer: means the individual who has been identified as the Englewood Local Liquor and Marijuana Licensing Authority and given the authority to grant, deny or revoke a liquor or marijuana license. Hearing Officer carries the same definition as that in 2-6-1(A)(2) of the Englewood Municipal Code. License: means to grant a license or registration pursuant to this Title. Page 130 of 319 9 Licensed Premises: means the premises specified in an application for a license under this Title, which are owned or in possession of the licensee and within which the licensee is authorized to cultivate, manufacture, distribute, or sell Medical Marijuana in accordance with the provisions of Article 43.3 of Title 12 C.R.S. Licensee: means a person licensed or registered pursuant to Article 43.3 of Title 12 C.R.S. and this Title. Local Licensing Authority: means the Englewood Local Liquor and Medical Marijuana Licensing Authority as established in E.M.C. 2-6-1. Local Licensing Official: means the Director of Finance and Administrative Services or designee, official designated to issue a license following approval by the Local Licensing Authority. Location: means a particular parcel of land that may be identified by an address or other descriptive means. Medical Marijuana: means Marijuana that is grown and/or sold pursuant to the provisions of § 106 of Article 1.5 of Title 12 C.R.S.; Article 43.3 of Title 12 C.R.S. and for a purpose authorized by Section 14 of Article XVIII of the State Constitution. Medical Marijuana Center: means a person licensed pursuant to Article 43.3 of Title 12 C.R.S. to operate a business as described in Article 43.3 of Title 12 C.R.S. that sells Medical Marijuana to registered patients or Primary Care-Givers as defined in Section 14 of Article XVIII of the State Constitution, but is not a Primary Care-Giver. Medical Marijuana-Infused Product: means a product infused with Medical Marijuana that is intended for use or consumption other than by smoking, including, but not limited to, edible products, ointments, and tinctures. These products, when manufactured or sold by a licensed Medical Marijuana Center or a Medical Marijuana-Infused Product Manufacturer, shall not be considered a food or drug for the purposes of the "Colorado Food and Drug Act", Part 4 of Article 5 of Title 25, C.R.S. Medical Marijuana-Infused Product Manufacturer: A person licensed pursuant to Article 43.3 of Title 12 C.R.S. to operate a business as described in Article 43.3 of Title 12 C.R.S. Medical Marijuana Optional Premises Cultivation Operation: means the premises specified in an application for a Medical Marijuana Center License with related growing facilities in Colorado for which the Licensee is authorized to grow and cultivate Marijuana for a purpose authorized by Section 14 of Article XVIII of the State Constitution. Multi-Tenant Building: A building that is or can be occupied by more than one tenant. Patient: a person who meets the definition of patient under Article XVIII, Section 14 (1)(d) of the Colorado Constitution and applicable law or regulation. Person: means a natural person, partnership, association, company, corporation, limited liability company, or organization, or a manager, agent, owner, director, servant, officer, or employee thereof. Premises: means a distinct and definite location, which may include a building, a part of a building, a room, or any other definite contiguous area. Page 131 of 319 10 Primary Care-Giver: In addition to the definitions set forth in Section 14(1) (f) of Article XVIII of the State Constitution, as used in Article 43.3 of Title 12 C.R.S., unless the context otherwise requires, "Primary Care-Giver" means a natural person, or as may be more fully defined in any applicable Federal or State law or regulation. School: means a public or private preschool or a public or private elementary, middle, junior high, or high school, college or campus of a college. Smoking: means the burning of a lighted cigarette, cigar, pipe, or any other matter or substance that contains tobacco or Medical Marijuana as defined by Article 43.3 of Title 12 C.R.S. State Licensing Authority: means the Authority created for the purpose of regulating and controlling the Licensing of the cultivation, manufacture, distribution, and sale of Medical Marijuana in this State, pursuant to Article 43.3 of Title 12 C.R.S. Amending Title 5, Section 5-3E-2 of the Englewood Municipal Code 5-3E-2: Powers and Duties of the Local Licensing Authority. A. The Local Licensing Authority as established in E.M.C. 2-6-1 shall grant or refuse local Licenses for the distribution and sale of Retail Marijuana as provided by law; suspend, fine, restrict, or revoke such Licenses upon a violation of this Chapter or a rule promulgated pursuant to this Chapter; and may impose any penalty authorized by this Chapter or any rule promulgated pursuant to this Chapter, the Local Licensing Authority may take action with respect to a License pursuant to this Title, and all in accordance with the authority and procedures established pursuant to this Chapter and in Title E.M.C. 2-6-1. B. The Local Licensing Authority shall promulgate such rules and make such special rulings and findings as necessary for the proper regulation and control of the distribution and sale of Retail Marijuana and for the enforcement of this Chapter. C. The Local Licensing Authority hereby adopts shall comply with the minimum licensing requirements of Article 43.4 of Title 12 C.R.S. to apply to in association with the issuance of a Retail Marijuana Store License. D. On and after January 1, 2017, the Local Licensing Authority shall begin receiving and processing applications under this Chapter. The Local Licensing Authority is authorized to administratively approve any License application under this Chapter so long as the conditions set forth in the Chapter are met and the applicant has paid the operating fee and any other fees required by this Chapter. E. Prior to January 1, 2019, the Local Licensing authority may receive and process applications for a Retail Marijuana Store pursuant to Section 5-3E-4 of this Chapter only if the applicant is a Medical Marijuana Center duly licensed as of June 1, 2016 under 5-3D-1 et. seq. of the Englewood Municipal Code 2000. Section 3. Effective Date. This ordinance shall be published in conformance with the Englewood City Charter and shall take effect and be in force on and after January 1, 2018. All ordinances or Page 132 of 319 11 provisions of the Englewood Municipal Code modified by this ordinance shall remain in effect until superseded on the effective date of this Ordinance on January 1, 2018. Section 4. The following general provisions shall apply to interpretation and application of this Ordinance: A. Severability. If any clause, sentence, paragraph, or part of this Ordinance or the application thereof to any person or circumstances shall for any reason be adjudged by a court of competent jurisdiction invalid, such judgment shall not affect, impair or invalidate the remainder of this Ordinance or it application to other persons or circumstances. B. Inconsistent Ordinances. All other Ordinances or portions thereof inconsistent or conflicting with this Ordinance or any portion hereof are hereby repealed to the extent of such inconsistency or conflict. C. Effect of repeal or modification. The repeal or modification of any provision of the Code of the City of Englewood by this Ordinance shall not release, extinguish, alter, modify, or change in whole or in part any penalty, forfeiture, or liability, either civil or criminal, which shall have been incurred under such provision, and each provision shall be treated and held as still remaining in force for the purposes of sustaining any and all proper actions, suits, proceedings, and prosecutions for the enforcement of the penalty, forfeiture, or liability, as well as for the purpose of sustaining any judgment, decree, or order which can or may be rendered, entered, or made in such actions, suits, proceedings, or prosecutions. D. Safety Clauses. The City Council hereby finds, determines, and declares that this Ordinance is promulgated under the general police power of the City of Englewood, that it is promulgated for the health, safety, and welfare of the public, and that this Ordinance is necessary for the preservation of health and safety and for the protection of public convenience and welfare. The City Council further determines that the Ordinance bears a rational relation to the proper legislative object sought to be obtained. Introduced, read in full, and passed on first reading on the 16th day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 19th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 18th day of October, 2017 for thirty (30) days. Joe Jefferson, Mayor ATTEST: _________________________________ Stephanie Carlile, City Clerk Page 133 of 319 12 I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of a Bill for an Ordinance, introduced, read in full, and passed on first reading on the 16th day of October, 2017. Stephanie Carlile Page 134 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Kathleen Rinkel DEPARTMENT: Finance & Administrative Services DATE: October 16, 2017 SUBJECT: 2018 City of Englewood Budget Ordinances -2nd Reading DESCRIPTION: 2018 City of Englewood Budget Ordinances -2nd Reading RECOMMENDATION: Staff recommends Council approve the proposed ordinance adopting the 2018 Budget. PREVIOUS COUNCIL ACTION: The 2018 initial budget projections were discussed with City Council on April 10, 2017, and each department presented their budget and policy issues to Council in meetings from April through July. The proposed 2018 Budget updates were provided on August 7, August 14 and August 22, 2017. The 2018 Proposed Budget for the City of Englewood, the 2018 Proposed Budget for the Littleton/Englewood Wastewater Treatment Plant and the 2018 Proposed Revenue Manual for the City of Englewood were posted to the City's website on September 6, 2017 and printed copies were available on September 7, 2017. A public hearing to gather citizen input regarding the 2018 Proposed Budget was held on September 18, 2017. As part of this hearing, the Budget Advisory Committee provided Council with their Annual Report regarding their findings and recommendations. SUMMARY: The Charter of the City of Englewood requires the City Council to adopt the next year's Budget and Appropriation Ordinances no later than thirty days prior to the first day of the next fiscal year to ensure there is legal authority to expend funds. (Article X, Part I, Section 90) The City of Englewood 2018 Budget was developed over the past five months with significant collaboration between Englewood residents, the City Council, and City staff. This year's thorough budget process leveraged our collective capacity to deliver quality city services, enhance public safety, and reinvigorate our existing city infrastructure. The 2018 Budget also moves forward our community's vision for a new safety services building. Page 135 of 319 Despite our fiscal challenges, this budget maintains our commitments through 2018. However, continued long-term planning and prioritization with the City Council and community is necessary to ensure sustainability into the future. ANALYSIS: The City of Englewood 2018 Budget is a structurally balanced budget, as required by City Charter and Resolution No. 51, Series of 2016. This means that across all funds, the City's revenues meet or exceed the City's Expenditures. The estimated ending Governmental Fund Balance for 2018 is $13,507,214. The estimated ending Proprietary Fund Balance for 2018 is $33,142,285. The difference between the Sources and Uses ($32,203,741) is due primarily to the Englewood Police Headquarters building expenditures in 2018 ($24,007,003 - net of investment income), as the bond proceeds were received in 2017, and investment in the Wastewater Treatment Plant's Biogas project (Sewer Fund; $4,793,402). The remaining $3,403,336 difference is across various funds and due to re-appropriation of expenditures that not spent in the prior year, or due to timing to build reserves to a level to be able to afford to do a larger project. Fund detail is reflected in the chart in the Financial Implications section below: FINANCIAL IMPLICATIONS: Page 136 of 319 Page 137 of 319 ALTERNATIVES: Per the Englewood City Charter (Article X, Part I, Section 90), Council shall adopt ordinances for the Budget and the Appropriation no less than thirty days prior to the first day of the next fiscal year, CONCLUSION: Staff supports this 2018 Budget and is looking forward to Council direction in addressing future budgets. ATTACHMENTS: Council Bill 53 Page 138 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 53 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER GILLIT AN ORDINANCE ADOPTING THE BUDGET OF THE CITY OF ENGLEWOOD, COLORADO, FOR FISCAL YEAR 2018. WHEREAS, pursuant to the provisions of Part I, Article X, § 82 of the Charter of the City of Englewood, Colorado, a budget for fiscal year 2018 was duly submitted by the City Manager to the City Council on September 11, 2017; WHEREAS, a public hearing on said budget was held by the City Council on September 18, 2017, in conformance with Part I, Article X, § 87 of the Charter of the City of Englewood, Colorado; WHEREAS, Regular notice of the time and place of said hearing was published in conformance with Part I, Article X, § 87 of the Charter of the City of Englewood, Colorado, such publication being in the Englewood Herald on August 31, 2017, September 7, 2017, and September 14, 2017, and on the Official City of Englewood, Colorado website from August 22, 2017 through September 18, 2017; and WHEREAS, the City Council of the City of Englewood has studied and/or discussed the budget at numerous public meetings during 2017, including July 10th, August 7th, August 14th, August 22nd, and September 18th. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. That the budget of the City of Englewood, Colorado, for fiscal year 2018, as submitted by the City Manager, duly considered by the City Council and with changes made by the City Manager to reflect Council discussion after public hearing, in conformance with Part I, Article X, § 88 of the Charter of the City of Englewood, Colorado, is adopted as the budget for the City of Englewood for the fiscal year 2018, in conformance with Part I, Article X, § 90 of the Charter of the City of Englewood, Colorado. [remainder of page intentionally blank] Page 139 of 319 2 Section 2. GENERAL FUND 2018 BUDGET Total Fund Balance, January 1, 2018 11,190,855$ REVENUES Sales/Use Tax 27,922,380$ Property and Specific Ownership Tax 4,327,000$ Franchise/Occupation/Cigarette Tax/Hotel 3,486,000$ License/Permits 1,375,804$ Intergovernmental Revenue 1,326,671$ Charges for Services 2,939,487$ Cultural & Recreation 2,844,600$ Fines & Forfeitures 891,450$ Interest 49,946$ Contribution from Component Units 1,548,000$ Other 597,476$ Total Revenues 47,308,814$ Other Financing Sources 120,272$ Total Sources of Funds 47,429,086$ EXPENDITURES Legislation 330,002$ City Manager's Office 7,133,210$ City Attorney’s Office 848,822$ Municipal Court 1,106,719$ Human Resources 771,274$ Finance and Administrative Services 1,494,052$ Information Technology 2,717,469$ Community Development 2,644,501$ Public Works 6,334,875$ Police Services 14,083,629$ Parks, Recreation and Library Services 7,609,755$ Communications 434,015$ Contingencies 228,300$ Debt Service 1,565,297$ Total Expenditures 47,301,920$ Other Financing Uses 500,000$ Total Uses of Funds 47,801,920$ Total Fund Balance, December 31, 2018 10,818,021$ Page 140 of 319 3 Section 3. SPECIAL REVENUE FUNDS Conservation Trust Fund Fund Balance, January 1, 2018 114,413$ Revenues 310,000$ Expenditures 310,000$ Fund Balance, December 31, 2018 114,413$ Donors Fund Fund Balance, January 1, 2018 604,009$ Revenues 107,560$ Expenditures 490,060$ Fund Balance, December 31, 2018 221,509$ Parks and Recreation Trust Fund Fund Balance, January 1, 2018 368,858$ Revenues 6,500$ Expenditures 300,000$ Fund Balance, December 31, 2018 75,358$ Malley Center Trust Fund Fund Balance, January 1, 2018 221,247$ Revenues 7,000$ Expenditures 100,000$ Fund Balance, December 31, 2018 128,247$ Open Space Fund Fund Balance, January 1, 2018 205,409$ Revenues 805,000$ Expenditures 615,000$ Fund Balance, December 31, 2018 395,409$ [remainder of page intentionally blank] Page 141 of 319 4 Section 4. DEBT SERVICE FUNDS General Obligation Bond Fund- Recreation Fund Balance, January 1, 2018 54,990$ Revenues 1,102,000$ Expenditures 1,105,688$ Fund Balance, December 31, 2018 51,302$ General Obligation Bond Fund-Police Headquarters Fund Balance, January 1, 2018 979,343$ Revenues 2,199,250$ Expenditures 2,215,813$ Fund Balance, December 31, 2018 962,780$ [remainder of page intentionally blank] Page 142 of 319 5 Section 5. CAPITAL PROJECT FUNDS Public Improvement Fund Fund Balance, January 1, 2018 902,861$ Revenues 3,390,000$ Expenditures 2,638,028$ Transfer In 500,000$ Transfer Out 1,787,324$ Fund Balance, December 31, 2018 367,509$ Capital Projects Fund Fund Balance, January 1, 2018 58,432$ Revenues 50,000$ Expenditures 1,965,833$ Transfer In 2,167,052$ Fund Balance, December 31, 2018 309,651$ Police Headquarters Construction Fund Fund Balance, January 1, 2018 24,070,017$ Revenues and Transfers In 150,000$ Expenditures 24,157,003$ Fund Balance, December 31, 2018 63,014$ [remainder of page intentionally blank] Page 143 of 319 6 Section 6. ENTERPRISE FUNDS Water Fund Fund Balance, January 1, 2018 11,801,963$ Revenues 8,790,323$ Expenditures 10,484,540$ Fund Balance, December 31, 2018 10,107,746$ Sewer Fund Fund Balance, January 1, 2018 6,382,232$ Revenues 16,249,395$ Expenditures 21,042,797$ Fund Balance, December 31, 2018 1,588,830$ Storm Drainage Fund Fund Balance, January 1, 2018 1,204,709$ Revenues 332,514$ Expenditures 479,012$ Fund Balance, December 31, 2018 1,058,211$ Golf Course Fund Fund Balance, January 1, 2018 691,841$ Revenues 2,266,300$ Expenditures 2,249,341$ Fund Balance, December 31, 2018 708,800$ Concrete Utility Fund Fund Balance, January 1, 2018 895,062$ Revenues 884,200$ Expenditures 898,565$ Fund Balance, December 31, 2018 880,697$ Housing Rehabilitation Fund Fund Balance, January 1, 2018 1,470,368$ Revenues 445,326$ Expenditures 568,505$ Transfer Out 500,000$ Fund Balance, December 31, 2018 847,189$ Page 144 of 319 7 Section 7. INTERNAL SERVICE FUNDS Central Services Fund Fund Balance, January 1, 2018 92,392$ Revenues 306,815$ Expenditures 275,983$ Fund Balance, December 31, 2018 123,224$ Servicenter Fund Fund Balance, January 1, 2018 775,901$ Revenues 2,234,958$ Expenditures 2,219,813$ Fund Balance, December 31, 2018 791,046$ Capital Equipment Replacement Fund Fund Balance, January 1, 2018 2,260,932$ Revenues 1,005,483$ Expenditures 1,393,857$ Fund Balance, December 31, 2018 1,872,558$ Risk Management Fund Fund Balance, January 1, 2018 484,291$ Revenues 1,401,443$ Expenditures 1,415,694$ Fund Balance, December 31, 2018 470,040$ Employee Benefits Fund Fund Balance, January 1, 2018 562,057$ Revenues 6,397,725$ Expenditures 5,773,051$ Fund Balance, December 31, 2018 1,186,731$ Section 8. That the said budget shall be a public record in the office of the City Clerk and shall be open to public inspection. Sufficient copies thereof shall be made available for the use of the City Council and the public, the number of copies to be determined by the City Manager all in conformance with Part I, Article X, § 86 of the Charter of the City of Englewood, Colorado,. Introduced, read in full, and passed on first reading on the 2nd day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 5th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 4th day of October, 2017 for thirty (30) days. Read by Title and passed on final reading on the 16th day of October, 2017. Page 145 of 319 8 Published by Title in the City’s official newspaper as Ordinance No. ___, Series of 2017, on the 20th day of October, 2017. Published by title on the City’s official website beginning on the 19th day of October, 2017 for thirty (30) days. This Ordinance shall take effect thirty (30) days after publication following final passage. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Ordinance passed on final reading and published by Title as Ordinance No. ___, Series of 2017. Stephanie Carlile Page 146 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Kathleen Rinkel DEPARTMENT: Finance & Administrative Services DATE: October 16, 2017 SUBJECT: 2018 City of Englewood Budget Appropriations - 2nd Reading DESCRIPTION: 2018 City of Englewood Budget Appropriations - 2nd Reading RECOMMENDATION: Staff recommends Council approve the proposed ordinance appropriating funds for 2018. PREVIOUS COUNCIL ACTION: The 2018 initial budget projections were discussed with City Council on April 10, 2017, and each department presented their budget and policy issues to Council in meetings from April through July. The proposed 2018 Budget updates were provided on August 7, August 14 and August 22, 2017. The 2018 Proposed Budget for the City of Englewood, the 2018 Proposed Budget for the Littleton/Englewood Wastewater Treatment Plant and the 2018 Proposed Revenue Manual for the City of Englewood were posted to the City's website on September 6, 2017 and printed copies were available on September 7, 2017. A public hearing to gather citizen input regarding the 2018 Proposed Budget was held on September 18, 2017. As part of this hearing, the Budget Advisory Committee provided Council with their Annual Report regarding their findings and recommendations. SUMMARY: The Charter of the City of Englewood requires the City Council to adopt the next year's Budget and Appropriation Ordinances no later than thirty days prior to the first day of the next fiscal year to ensure there is legal authority to expend funds. The City of Englewood 2018 Budget was developed over the past five months with significant collaboration between Englewood residents, the City Council, and City staff. This year's thorough budget process leveraged our collective capacity to deliver quality city services, enhance public safety, and reinvigorate our existing city infrastructure. The 2018 Budget also moves forward our community's vision for a new safety services building. Page 147 of 319 Despite our fiscal challenges, this budget maintains our commitments throug h 2018. However, continued long-term planning and prioritization with the City Council and community is necessary to ensure sustainability into the future. ANALYSIS: The City of Englewood 2018 Budget is a structurally balanced budget, as required by City Charter. This means that across all funds, the City's revenues meet or exceed the City's Expenditures. The estimated ending Governmental Fund Balance for 2018 is $13,507,214. The estimated ending Proprietary Fund Balance for 2018 is $33,142,285. The difference between the Sources and Uses ($32,203,741) is due primarily to the Englewood Police Headquarters building expenditures in 2018 ($24,007,003 - net of investment income), as the bond proceeds were received in 2017, and investment in the Wastewater Treatment Plant's Biogas project (Sewer Fund; $4,793,402). The remaining $3,403,336 difference is across various funds and due to re-appropriation of expenditures that not spent in the prior year, or due to timing to build reserves to a level to be able to afford to do a larger project. Fund detail is reflected in the chart in the Financial Implications section below: FINANCIAL IMPLICATIONS: Page 148 of 319 Page 149 of 319 ALTERNATIVES: Per the Englewood City Charter (Article X, Part I, Section 90), Council shall adopt ordinances for the Budget and the Appropriation no less than thirty days prior to the first day of the next fiscal year, CONCLUSION: Staff supports this 2018 Budget and is looking forward to Council direction in addressing future budgets. ATTACHMENTS: Council Bill 52 Page 150 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 52 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER GILLIT AN ORDINANCE APPROPRIATING MONIES FOR ALL MUNICIPAL PURPOSES IN THE CITY OF ENGLEWOOD, COLORADO, FOR FISCAL YEAR BEGINNING JANUARY 1, 2018, AND ENDING DECEMBER 31, 2018, CONSTITUTING WHAT IS TERMED THE ANNUAL APPROPRIATION BILL FOR FISCAL YEAR 2018. WHEREAS, a public hearing on said budget was held by the City Council on September 18, 2017, in conformance with Part I, Article X, § 87 of the Charter of the City of Englewood, Colorado; WHEREAS, the operating budgets and Multiple Year Capital Plan for all City departments and funds were reviewed at budget workshops held on August 7, 14 and August 22; and WHEREAS, Part I, Article X, § 90 of the Charter of the City of Englewood, Colorado requires the City Council to adopt a bill for the annual Appropriations by ordinance no later than thirty days prior to the first day of the next fiscal year. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. Pursuant to, and in conformance with, Part I, Article X, §§ 90, 92, 93, and 94 of the Charter of the City of Englewood, Colorado, the several sums of money hereinafter specified are hereby appropriated out of the revenue of the City of Englewood, Colorado, for the year 2018, and out of the respective fund balances, to the several purposes herein named to meet the expenses of the City of Englewood for the year 2018, specifically as follows: [remainder of page intentionally blank] Page 151 of 319 2 GENERAL FUND Legislation 330,002$ City Manager's Office 7,133,210$ City Attorney's Office 848,822$ Municipal Court 1,106,719$ Human Resources 771,274$ Finance and Administrative Services 1,494,052$ Information Technology 2,717,469$ Community Development 2,644,501$ Public Works 6,334,875$ Police 14,083,629$ Parks, Recreation and Library Services 7,609,755$ Communications 434,015$ Contingencies 228,300$ Debt Service – Civic Center 1,445,025$ Debt Service – Other 120,272$ Other Financing Uses 500,000$ Total General Fund 47,801,920$ CONSERVATION TRUST FUND Total Conservation Trust Fund 310,000$ DONORS FUND Total Donors Fund 490,060$ PARKS AND RECREATION TRUST FUND Total Parks and Recreation Trust Fund 300,000$ MALLEY CENTER TRUST FUND Total Malley Center Trust Fund 100,000$ OPEN SPACE FUND Total Open Space Fund 615,000$ Page 152 of 319 3 GENERAL OBLIGATION BOND FUND-RECREATION Total General Obligation Bond Fund 1,105,688$ GENERAL OBLIGATION BOND FUND-POLICE HEADQUARTERS Total General Obligation Bond Fund 2,215,813$ PUBLIC IMPROVEMENT FUND Total Public Improvement Fund 4,425,352$ CAPITAL PROJECTS FUND Total Capital Projects Fund 1,965,833$ POLICE HEADQUARTERS CONSTRUCTION FUND Total Police Headquarters Construction Fund 24,157,003$ WATER FUND Total Water Fund 10,484,540$ SEWER FUND Total Sewer Fund 21,042,797$ STORM DRAINAGE FUND Total Storm Drainage Fund 479,012$ GOLF COURSE FUND Total Golf Course Fund 2,249,341$ CONCRETE UTILITY FUND Total Concrete Utility Fund 898,565$ HOUSING REHABILITATION FUND Total Housing Rehabilitation Fund 1,068,505$ Page 153 of 319 4 CENTRAL SERVICES FUND Total Central Services Fund $275,983 SERVICENTER FUND Total ServiCenter Fund $2,219,813 CAPITAL EQUIPMENT REPLACEMENT FUND Total Capital Equipment Replacement Fund $1,393,857 RISK MANAGEMENT FUND Total Risk Management Fund $1,415,694 EMPLOYEE BENEFITS FUND Total Employee Benefits Fund $5,773,051 Section 2. The foregoing appropriations shall be considered to be appropriations to groups within a program or department within the fund indicated but shall not be construed to be appropriated to line items within any groups, even though such line items may be set forth and included with the adopted budget for the fiscal year 2018. Section 3. All monies in the hands of the Director of Finance and Administrative Services, or to come into the Director's hands for the fiscal year 2018, may be applied to any outstanding claims now due or to become due in the said fiscal year of 2018. Section 4. All unappropriated monies that may come into the hands of the Director of Finance and Administrative Services during the year 2018, may be so distributed among the respective funds herein as the City Council may authorize in accordance with applicable law. Section 5. During or at the close of the fiscal year of 2017, any surplus money in any of the respective funds, after all claims for 2017 against the same have been paid, may be distributed to any other fund or funds at the discretion of the City Council. Introduced, read in full, and passed on first reading on the 2nd day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 5th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 4th day of October, 2017 for thirty (30) days. Page 154 of 319 5 Read by Title and passed on final reading on the 16th day of October, 2017. Published by Title in the City’s official newspaper as Ordinance No. ___, Series of 2017, on the 20th day of October, 2017. Published by title on the City’s official website beginning on the 19th day of October, 2017 for thirty (30) days. This Ordinance shall take effect thirty (30) days after publication following final passage. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Ordinance passed on final reading and published by Title as Ordinance No. ___, Series of 2017. Stephanie Carlile Page 155 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Kathleen Rinkel DEPARTMENT: Finance & Administrative Services DATE: October 16, 2017 SUBJECT: 2018 LEWWTP Budget Ordinances - 2nd Reading DESCRIPTION: 2018 LEWWTP Budget Ordinances - 2nd Reading RECOMMENDATION: Staff recommends Council approve the proposed ordinance adopting the Littleton/Englewood Wastewater Treatment Plant Budget for fiscal year 2018. PREVIOUS COUNCIL ACTION: The 2018 initial budget projections were discussed with City Council on April 10, 2017, and each department presented their budget and policy issues to Council in meetings from April through July. The proposed 2018 Budget updates were provided on August 7, August 14 and August 22, 2017. The 2018 Proposed Budget for the City of Englewood, the 2018 Proposed Budget for the Littleton/Englewood Wastewater Treatment Plant and the 2018 Proposed Revenue Manual for the City of Englewood were posted to the City's website on September 6, 2017 and printed copies were available on September 7, 2017. A public hearing to gather citizen input regarding the 2018 Proposed Budget was held on September 18, 2017. As part of this hearing, the Budget Advisory Committee provided Council with their Annual Report regarding their findings and recommendations. SUMMARY: The City Council of the City of Englewood acts as administering authority for the Littleton/Englewood Wastewater Treatment Plant. Part of the duties of the City Council includes adopting ordinances for the 2018 Budget and Appropriation no later than thirty days prior to the first day of the next fiscal year. ANALYSIS: The 2018 Littleton/Englewood Wastewater Treatment Plant Budget indicates a beginning funds available balance of $115,674, total sources of funds of $26,869,791 and total uses of funds of $26,869,791, leaving the ending funds balance at $115,674. The sources and uses of funds are complementary as all expenditures at the plant are shared and billed out on a cost Page 156 of 319 reimbursement basis to both the City of Littleton and the City of Englewood based on the Joint Use Agreement. FINANCIAL IMPLICATIONS: The proposed use of funds for 2018 of $26,869,791 are $7,714,549 greater than the approved 2017 budget of $19,155,242 primarily due to the installation of the Biogas reclamation project. ALTERNATIVES: Per the Englewood City Charter, Council shall adopt ordinances for the Budget and the Appropriation no less than thirty days prior to the first day of the next fiscal year, CONCLUSION: Staff has provided a Wastewater Treatment budget that meets the needs of the two partnership cities, all State and Federal Standards and supports environmental responsibility. ATTACHMENTS: Council Bill 56 Page 157 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 56 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER GILLIT AN ORDINANCE ADOPTING THE BUDGET FOR THE LITTLETON/ ENGLEWOOD WASTEWATER TREATMENT PLANT FOR FISCAL YEAR 2018. WHEREAS, Pursuant to the provisions of an agreement between the City of Littleton, Colorado, and the City of Englewood, Colorado, a budget for fiscal year 2018 was submitted to the Littleton/Englewood Wastewater Treatment Plant Supervisory Committee at their regular meeting of August 17, 2017; WHEREAS, The aforedescribed budget was submitted to the City Council of the City of Englewood, as the administering authority for the Littleton/Englewood Wastewater Treatment Plant, on September 11, 2017; WHEREAS, A public hearing on said budget was held by the City Council on September 18, 2017; WHEREAS, Regular notice of the time and place of said hearing was published in the Englewood Herald on August 31, 2017, September 7, 2017, and September 14, 2017, and on the Official City of Englewood, Colorado website from August 22, 2017 through September 18, 2017; WHEREAS, The City Council of the City of Englewood, as the administering authority for the Littleton/Englewood Wastewater Treatment Plant, has studied and/or discussed the budget at numerous public meetings during 2017, including July 10th, August 7th, August 14th, August 22nd, and September 18th; and WHEREAS, It is the intent of the City Council to adopt the 2018 budget for the Littleton/Englewood Wastewater Treatment Plant as now submitted. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. That the budget of the Littleton/Englewood Wastewater Treatment Plant for fiscal year 2018, as submitted by the Littleton/Englewood Wastewater Treatment Plant Supervisory Committee and duly considered by the City Council after public hearing, is hereby adopted as the budget for the Littleton/Englewood Wastewater Treatment Plant for the fiscal year 2018, as follows: Littleton/Englewood Wastewater Treatment Plant Fund Balance – January 1, 2018 $ 115,674 Page 158 of 319 2 Revenues $ 26,869,791 Expenditures $ 26,869,791 Fund Balance – December 31, 2018 $ 115,674 Section 2. That the said budget as accepted shall be a public record in the Office of the City Clerk and shall be open to public inspection. Sufficient copies thereof shall be made available for the use of the City Council and the public, the number of copies to be determined by the City Manager. Introduced, read in full, and passed on first reading on the 2nd day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 5th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 4th day of October, 2017 for thirty (30) days. Read by Title and passed on final reading on the 16th day of October, 2017. Published by Title in the City’s official newspaper as Ordinance No. ___, Series of 2017, on the 20th day of October, 2017. Published by title on the City’s official website beginning on the 19th day of October, 2017 for thirty (30) days. This Ordinance shall take effect thirty (30) days after publication following final passage. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Ordinance passed on final reading and published by Title as Ordinance No. ___, Series of 2017. Stephanie Carlile Page 159 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Kathleen Rinkel DEPARTMENT: Finance & Administrative Services DATE: October 16, 2017 SUBJECT: 2018 LEWWTP Budget Appropriation - 2nd Reading DESCRIPTION: 2018 LEWWTP Budget Appropriation - 2nd Reading RECOMMENDATION: Staff recommends Council approve the proposed ordinance appropriating funds for the Littleton/Englewood Wastewater Treatment Plan for fiscal year 2018. PREVIOUS COUNCIL ACTION: The 2018 initial budget projections were discussed with City Council on April 10, 2017, and each department presented their budget and policy issues to Council in meetings from April through July. The proposed 2018 Budget updates were provided on August 7, August 14 and August 22, 2017. The 2018 Proposed Budget for the City of Englewood, the 2018 Proposed Budget for the Littleton/Englewood Wastewater Treatment Plant and the 2018 Proposed Revenue Manual for the City of Englewood were posted to the City's website on September 6, 2017 and printed copies were available on September 7, 2017. A public hearing to gather citizen input regarding the 2018 Proposed Budget was held on September 18, 2017. As part of this hearing, the Budget Advisory Committee provided Council with their Annual Report regarding their findings and recommendations. SUMMARY: The City Council of the City of Englewood acts as the administering authority for the Littleton/Englewood Wastewater Treatment Plant. Part of the duties of the Council include adopting ordinances for the 2018 Budget and Appropriation no later than thirty days prior to the first day of the fiscal year. ANALYSIS: The 2018 Littleton/Englewood Wastewater Treatment Plant Budget indicates a beginning funds available balance of $115,674, total sources of funds of $26,869,791 and total uses of funds of $26,869,791, leaving the ending funds balance at $115,674. The sources and uses of funds are complementary as all expenditures at the plant are shared and billed out on a cost Page 160 of 319 reimbursement basis to both the City of Littleton and the City of Englewood based on the Joint Use Agreement. The total appropriation (use of funds) for 2018 is $26,869,791. FINANCIAL IMPLICATIONS: The proposed use of funds for 2018 of $26,869,791 are $7,714,549 greater than the approved 2017 budget of $19,155,242 primarily due to the installation of the Biogas reclamation project. ALTERNATIVES: Per the Englewood City Charter, Council shall adopt an ordinance for the Budget and the Appropriation no less than thirty days prior to the first day of the next fiscal year, CONCLUSION: Staff supports and recommends Council approve this ordinance appropriating funds for the Littleton/Englewood Wastewater Treatment Plan for fiscal year 2018. ATTACHMENTS: Council Bill 54 Page 161 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 54 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER GILLIT AN ORDINANCE APPROPRIATING MONIES FOR THE LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT PURPOSES IN THE FISCAL YEAR BEGINNING JANUARY 1, 2018, AND ENDING DECEMBER 31, 2018, CONSTITUTING WHAT IS TERMED THE ANNUAL APPROPRIATION BILL FOR FISCAL YEAR 2018. WHEREAS, the Cities of Englewood and Littleton entered into a contract to build, maintain, and operate a joint Wastewater Treatment Plant facility; WHEREAS, the operations, including budget matters, of this joint facility are overseen by a designated Supervisory Committee; WHEREAS, the City of Englewood operates the Littleton/Englewood Wastewater Treatment Plant under the control of the Supervisory Committee; WHEREAS, the Littleton/Englewood Wastewater Treatment Plant maintains a fund for its operations and maintenance separate from either the City of Englewood or the City of Littleton; and WHEREAS, the Supervisory Committee reviewed the following proposed 2018 appropriations at their regular meeting held on August 17, 2017. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. Pursuant to the Littleton/Englewood Wastewater Treatment Plant agreement entered into by the Cities of Englewood and Littleton, there is appropriated from the revenue derived from operation of the Littleton/Englewood Wastewater Treatment Plant in the City of Englewood, Colorado, and from all other sources of revenue in the Littleton/Englewood Wastewater Treatment Plant Fund including available fund balance during the year beginning January 1, 2018, and ending December 31, 2018, the amount hereinafter set forth: Total Littleton/Englewood Wastewater Treatment Plant Fund $ 26,869,791 Introduced, read in full, and passed on first reading on the 2nd day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 5th day of October, 2017. Page 162 of 319 2 Published as a Bill for an Ordinance on the City’s official website beginning on the 4th day of October, 2017 for thirty (30) days. Read by Title and passed on final reading on the 16th day of October, 2017. Published by Title in the City’s official newspaper as Ordinance No. ___, Series of 2017, on the 20th day of October, 2017. Published by title on the City’s official website beginning on the 19th day of October, 2017 for thirty (30) days. This Ordinance shall take effect thirty (30) days after publication following final passage. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Ordinance passed on final reading and published by Title as Ordinance No. ___, Series of 2017. Stephanie Carlile Page 163 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Kathleen Rinkel DEPARTMENT: Finance & Administrative Services DATE: October 16, 2017 SUBJECT: Establish 2017 Mill Levy (Collected in 2018) - 2nd Reading DESCRIPTION: Establish 2017 Mill Levy (Collected in 2018) - 2nd Reading RECOMMENDATION: Staff recommends that Council approve an ordinance establishing the 2017 mill levy to be collected in 2018. PREVIOUS COUNCIL ACTION: The 2018 initial budget projections were discussed with City Council on April 10, 2017, and each department presented their budget and policy issues to Council in meetings from April through July. The proposed 2018 Budget updates were provided on August 7, August 14 and August 22, 2017. The 2018 Proposed Budget for the City of Englewood, the 2018 Proposed Budget for the Littleton/Englewood Wastewater Treatment Plant and the 2018 Proposed Revenue Manual for the City of Englewood were posted to the City's website on September 6, 2017 and printed copies were available on September 7, 2017. A public hearing to gather citizen input regarding the 2018 Proposed Budget was held on September 18, 2017. As part of this hearing, the Budget Advisory Committee provided Council with their Annual Report regarding their findings and recommendations. SUMMARY: The City of Englewood assesses property tax for the general governmental operations and for the General Obligation Bonds Debt Service Funds. TABOR restricts the City from raising the mill levy without a vote of the citizens. ANALYSIS: This year's General Fund mill levy remains unchanged at 5.880 mills. The General Obligation Bonds Debt Service mill levy is 1.609 mills for the Recreation General Obligation Bond Debt Service (down from 1.919 mills in 2016) and 3.207 mills for the Englewood Police Headquarters General Obligation Bond Debt Service (down from 3.819 mills in 2016). The 2017 mill levy total of 10.696 for collection in 2018 is certified to Arapahoe County by December 15, 2017. Page 164 of 319 FINANCIAL IMPLICATIONS: This collection of property tax will cover the debt service requirements of our General Obligation Bonds and the 2018 Property Tax revenue estimate for the General Fund. Based on the assessed valuation for the City of Englewood as certified by the Arapahoe County Assessor, the estimated net assessed value of all properties in Englewood for 2017 is $686,067,418 compared to $575,373,717 for 2016. The next bi-annual property appraisal carried out by the Arapahoe County Assessor's Office is scheduled for 2019, payable in 2020. Effective January 1, 2018, the residential assessment rate changed from 7.96% to 7.20% for 2017. The 2017 mill for General Fund operations is 5.880. The General Obligation Bonds (GO) Debt Service mill levy is 1.609 mills for the Recreation GO Bond Debt Service and 3.207 mills for the Englewood Police Headquarters GO Bond Debt Service. The total mill levy is 10.696 for 2017 collected in 2018. The amount budgeted for the General Fund is $4,002,000 (net of uncollectibles, abatements, etc.). The budgeted amount for the Recreation GO Bonds Debt Service Fund is $1,100,000 and the budgeted amount for the Englewood Police Headquarters GO Bond Debt Service Fund is $2,196,750 (net of uncollectibles, abatements, etc.). Tax impact example - an Englewood homeowner with a $200,000 home would pay the following to the City of Englewood: Market Value $200,000 Assessment Ratio 7.2% Assessed Value $14,400 General Operation Mill Levy 5.880 Taxes Paid for General Fund Operations $84.67 Market Value $200,000 Assessment Ratio 7.2% Assessed Value $14,400 Recreation GO Bond Fund Mill Levy 1.609 Taxes Paid for Recreation GO Bond Fund $23.17 Market Value $200,000 Assessment Ratio 7.2% Assessed Value $14,400 Police Headquarters GO Bond Fund Mill Levy 3.207 Taxes Paid for Police Headquarters GO Bond Fund $46.18 . Market Value $200,000 Assessment Ratio 7.2% Assessed Value $14,400 Total Mill Levy 10.696 Taxes Paid for Total Mill Levy $154.02 Page 165 of 319 ALTERNATIVES: Per Englewood City Charter (Article X, Part I, section 89:Certification of Tax Levy): "If Council fails in any year to make a tax levy by October 16th, then the rate last fixed shall be the rate for the ensuing year which rate shall be levied as by law provided." CONCLUSION: These taxes are needed to support the 2018 Budget as proposed and to honor our debt obligations. ATTACHMENTS: Council Bill 55 Page 166 of 319 1 BY AUTHORITY ORDINANCE NO. ____ COUNCIL BILL NO. 55 SERIES OF 2017 INTRODUCED BY COUNCIL MEMBER GILLIT AN ORDINANCE FIXING THE TAX LEVY IN MILLS UPON EACH DOLLAR OF THE ASSESSED VALUATION OF ALL TAXABLE PROPERTY WITHIN THE CITY OF ENGLEWOOD, COLORADO. WHEREAS, it is the duty of the City Council of the City of Englewood, Colorado, under the Englewood Home Rule Charter and Colorado Revised Statutes, to make the annual property levy for City purposes; and WHEREAS, the City Council has duly considered the estimated valuation of all the taxable property within the City and the needs of the City and of each of said levies and has determined that the levies as hereinafter set forth, are proper and wise; and WHEREAS, the proposed levies are permitted under Article X, Section 20 of the Colorado Constitution without a vote by the citizens; NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF ENGLEWOOD, COLORADO, THAT: Section 1. That there be and hereby is levied for the year of 2017, due and payable as required by statute in the year 2018, for the City of Englewood, Colorado, an ad valorem tax of: 5.880 mills on the dollar for the General Fund of the City of Englewood, Colorado, 1.609 mills on the dollar for the Recreation General Obligation Bond Debt Service Fund, and 3.207 mills on the dollar for the Englewood Police Headquarters General Obligation Bond Debt Service Fund. That the levy hereinabove set forth shall be levied upon each dollar of the assessed valuation of all taxable property within the corporate limits of the City of Englewood, Colorado, and the said levy shall be certified by law. Introduced, read in full, and passed on first reading on the 2nd day of October, 2017. Published by Title as a Bill for an Ordinance in the City’s official newspaper on the 5th day of October, 2017. Published as a Bill for an Ordinance on the City’s official website beginning on the 4th day of October, 2017 for thirty (30) days. Read by Title and passed on final reading on the 16th day of October, 2017. Published by Title in the City’s official newspaper as Ordinance No. ___, Series of 2017, on the 20th day of October, 2017. Published by title on the City’s official website beginning on the 19th day of Page 167 of 319 2 October, 2017 for thirty (30) days. This Ordinance shall take effect thirty (30) days after publication following final passage. Joe Jefferson, Mayor ATTEST: Stephanie Carlile, Acting City Clerk I, Stephanie Carlile, Acting City Clerk of the City of Englewood, Colorado, hereby certify that the above and foregoing is a true copy of the Ordinance passed on final reading and published by Title as Ordinance No. ___, Series of 2017. Stephanie Carlile Page 168 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: Dave Lee DEPARTMENT: Parks, Recreation & Library DATE: October 16, 2017 SUBJECT: Belleview Park Improvement Project DESCRIPTION: Belleview Park Improvement Project RECOMMENDATION: The Parks, Recreation and Library Services Department recommends that Council approve, by motion, the contract for construction with Construction Concepts, Inc. for the Belleview Park Improvement Project. PREVIOUS COUNCIL ACTION: Ordinance No. 46, Series of 2017, authorizing an IGA with Arapahoe County Open Space for use of funds pertaining to the Belleview Park Improvement Project. Resolution No. 8, Series of 2017, authorizing an Arapahoe County Open Space grant application for the Belleview Park Improvement Project. SUMMARY: Arapahoe County Open Space notified the City of Englewood that the Belleview Park Improvements grant was approved by the County Commissioners in June 2017. The grant funding will allow for the construction of a shelter, trails, picnic tables, grills, vault toilet and a 15 space parking lot. ANALYSIS: The previous shelter had to be removed due to rotting timbers and other unsafe conditions. The new park improvements will allow citizens an opportunity to better utilize the upper western portions of Belleview Park for picnics and relaxation. Fees for use of the shelter will provide income throughout the summer months. FINANCIAL IMPLICATIONS: Five bids were received for this improvement project. Construction Concepts, Inc. submitted the lowest bid in the amount of $244,021.00. Funding for the project has been allocated in the 2017 Open Space Fund, with $250,000 in Arapahoe County Open Space (ACOS) grant funding and $83,900 in matching funds for a total of $333,900. After this expenditure, the remaining fund balance will be $1,400,534.91 as shown in the budget recap below: Page 169 of 319 12/31/2016 Beginning Fund Balance $1,675,962.00 2017 Estimated Sources of Funds $ 806,427.00 YTD Expenditures and Encumbrances ($ 997,954.09) (YTD as of 8/31/17) Matching Fund Expense ($ 83,900.00) YTD Remaining Fund Balance $1,400,534.91 CONCLUSION: Belleview Park will now have a total of four up-to-date shelters, increasing the availability of picnic areas for our park patrons. ATTACHMENTS: Contract CFC 17-32 Schedule A Bid Tabulation Sheet Certificate of Liability Insurance Map Open Space Budget page Page 170 of 319 I.H._mmm_m<<oon_ umonczmzmzau_<_m_oz ooz..m>o4u010:3»mt.S._ ._.I_mOOz._._»>O._.magmm=mm3m:._38»manmz?mqmaE8E_mSE.5oqmmEm:.Em?moi‘c<mag_82<$: Em0.22m:m_m<<oon_m3::_o_um_oo?oamzoz2Emmaa30o_oBao:mamEmnmaqm?mama8mmEm..O:<=_mam oo:m=.:n:o:OosnmvnmEn;<Eomm8558_m:33Emmaw.a....._.o:m3o:r00women.A._Oo:=mn_o3_ oo33m:o_:nonEm8...am?m3wm?maumr8:.mioozzzszn8.m.“_mmm"8::8a_m<mEmammnmqEmO5. mQ<m;_wmaEm:mmm_ma_u3uomm_m29.5cm?mom_<ma81:3_w:Emm__Eco:8o_m_m:vu__mm_mn:_uEm2_3m.m:m_m manm<mQE_:©smommmmémammagma8?Em8__o<<Em” _u_»o._mo?wm__m<_m<<mm;_§§.o<m3m:._u§.m2 <<:mmm>m<u8vowm_mucqmcmi8$3ma<m:_mm3m3:m<mumm:amom_<ma3Em_<_m<o1mag92oo::o__mag :m<mwmmz8:583EmU:mo8?2_um:Am_mm?mmzozw_.E$:<8Em_<_m<onman0.?Oo::o__<<_E m ~moo33m:gm:o:EBmoozqmo.8aE0}cmmémama8Emmco<m:m3mqOo::mo8.sEoEmmEm_o<<mm_am=mc_m mam?mmuo:mE_m2&9Em?mao?m.mag <<:mmm>m_vc?mcmsn8$5amoo33m:Qm._o:‘EmOo:=mo.Emmcmm:mém?ma8Emmco<m:m3mQOo:._.mo_2 u<Em_<_m<Sm:o_0.20950:man3.”.Oo:=mo8~_w:92<<..8manmzm8vm:.o:.:m__2mmaSo}3 mooozumsom<<_E$5mQ<m:_mm3m3magEm_u8uowm_. zO<<azmmmmom?Eooswamrmzoz2Emooaumzmmzoz8cmumamagEmSo}8cmumnozsma::am_.EH 8352.Emumamm3cEm__<mmqmmmm8__o<<m_ >.oo::mo.Uoocamamu=Gmmqmma3Emumamm.668Em:Em8__o<<_:m__m~2_:m=:3m:.m_Em<<_:mw magQoocamam2:8:mmmzmozma2Emo€oS8aw<?mamamsomoo:wESmmagm:m__cmqmnwzma8 m_Em?mmEmOozrmo?UoocamimSEm00230.magm__9.$5Em=:3m3m_Eméimm.man aoocamim8xm:8mmEm?mmm<,Eo_moo:wESmEmOoszmo._um2<mm:Emumamm:m?m8manEm<mm mmE__<mum:o2:_mmm~mmEm3mm:Em<imammm”o:.<m3m:3magEE. _:<:m:o:8mamanm:%oa5Ooocamam Ooszmo.AE_mEm=:3m:o >__mammmuosmmUoo:3m3m omzsom?m2Em?msom wmomm2<<o:n.25Oo::mo8qmm?mmm8manmEm__Sim:m__Eco:8o_m.m:uv__mm.mn:83m:__ 3m_m1m_mmanm<mQEEczmomwwmé8«man52:88me.8:23magoo3v_m_mm__Em<<oE%m2_c8_. a_E<<:_mm.8E.wsossmanEo_:umn_EmmaOo:=mo_Uoo:Em3w. O.Amzsw2_um:.o::m:om”._.:mOo::.mo.Smmqmmm8czamnmxmEmvmloqamzom3Em<<o2AE89Ea 003822.3.:3::3c_mKm:03cmEm_§_.._8_8oo33m:omSo}3Em0:93.3_um:Am_ 2852.0:w_.EEQ. 38mzeméooaum:é<m<.m:n_m<<ooa_oo_o$aomg8.88 8983380s2<<<.m:o_m<<ooamo<.o6 mania»m..._as.¥hm?_:63<m3m3__u3_mn_Page 171 of 319 U._:am3:_.._om:o:”._.:m923.32mag_u<Emm>9mmEm:<oo::mo_momm:2mmqmm8_:Qm3:_2_Ema:m::_mmw.mxozm?mmm2mmm:3mEmmmamswm2EmOo::mo8qQm:<oEm?umaoz0..m:E<_8am:< vc?omm.?..mOozqmoz:mEm__mama.EamE::<mamm<mEmzammmEmQ2..8o3omG_mmmammag m3_o_o<mmw=03m:<msgm__o.m_Em_$323.mcnw.mozozm9u8ommaEmmoqm:<:32:mEamEo_cn_En <<oEm1.wOo3um:mm:o:o_m_Em_Em:<<<m<qmm:=Em2032m:mE,a9:2Ea>9mmEm:<Oo::m9H 38,38.Eo<<m<mrEm,EmOo::mo8qEmma:9_:%3:.20..mm<m:m::_mmmEm0.2..8o3nmE_mmms?magmEu_o<mmm:03Qmammmmnmmc_..Ec:03Emmo_m:mm_6m:om2EmO=<.mo3om«w_mmmammza mEu_o<mmm. m.._.m:EEm=o:oq><<ma2:Oo:<m:_m:om“._.:m0.23m<_m::Em.mEmmémammm:<23m3o_<Ew212% Eozom8EmOo:=mo8~2man:_m3.Em:o:magmmmo:<E@Emmmmo._<m$52wco:_m3.Em=o:.m._mmmH Ei<G8qm<mcm?oqmEmmmmo:<mmm.m9.man:_mEEm:o:.EEm.m<m:.m__E_m:ma2§Ea:8_wm«<8m_ ~mmo:m_3m.m:m_AmvEmumqmmo1cE_m:ma3Emoo::mo8«~52EmmémamEm__.mmEmouzoz2EmOE: cmooEm=mm8nm:<._..Emméma_m?m3..Em.mQ3Em03mmmagmaEm?mE_EmOo::mo8?2.:cmnma Em»mEo::»sE_o:EmmaEmmmEmam:8Em8..m_ooaumzmmzozmmEmmm2_ommmoEm__<mm_.8::ma2 3m»m:m_EE.wEmacmm.8Em8~m_mm2_omw\3m.m1m_mEmm:oommmE_E3mo?mmm8cmnozsS52Ea méma‘_mmm_om<3m:_m2ooaumsmmzoz§m<_o:m_<Emam.:Emméma8::Em.mamam8Em8::o2Em Oo:=mo8~Emo_m:mm~m_mHEo8~m::Em.8:2Emm<<ma8aomzmmmEm__mEu_<. _u.._.m::Em:o:3><<ma8aOmcwmn:_33%.:m:<omcmm.Emoo::mo8q£5:8:8EEm=Em_<mam Eovm?3m_Em?=moE_6m:o:mom2EmOo::mo8?mEm__<_o_m.mm:<2Emoo<m:m:.m_mm?mmamam2m:u:_m:o:w2Emméma.Em0.2w:m__Em<mEm:9:8_m:.:Em.mEmméma3m_<EmsizmzEozom8 EmOozzmo?oa2man:~m::Em=o:manm_omo5.EeEmmmmo:<mQm.m28:.:Em=o:.EEm»m<m:.pm__ 331.32::_.E_mEmamm2_omm_m.Emoumo:2EmOE:cmooam.8u8um:<_mamEm003.308..m:m__ um%a_$8?momzmEmrmn::mm_moo3um:mm:o:8wm:<mmzm?m?oé<8}Qoo:Em:.m.Emumama ooEu_m.mm9.3mHm1m_mmm83_mEmm. zo.<<_EmHm:mEmEmmwo<m.EmOo::mo8nm:m__:9cm~m__m<mn_2Em__mE__Q8Em0.28a qmEmmmmmcm.mEmac<EmO3.3<EEm9.Emma:9Emm<<m&3Emoo:=mo8~mamEm o=<Em<<<_E:oEm:<_mm<3m:»m8EmOo::mo8?8*Emuc?omm2mm»on:3:man:23¢ mmEmmxmm»m3o:2oqgmEmm_mmQcmEm03183Emoo:.:mo81m%§3_:8_. ._.m3._m2mmEms.”.250.2mm?mmm8nm<EmOo::mo81oqEm_um_.8:.:m:om2m__EmSo}«magma 55.2E_mooznmormamEmOo::mo8«mmammw8mommu.mmam8:mano:_<ooaumsmmzozEm?m8?m_ 98:m5:9m:Em23o:m<mm3m<cmEovmqEmooo?mzom<sEEmvzom2uzommmm»8::EEm Oo::mo81wm8uomm_mzmormgmamEmammcm:EmqmonEm8.Hm_mm=Em8aoow?Emqmo?_mmEmE Icsaama_uo:<mocq1.0595mzm.?<m:~<O:mUo__ma.a~t..o§.o9_>mg.qm.mEmmm9Em mém?man3__mo.m3o:3<<=_mm<<_EEm_g::=_Em_Emumozozmzamoomu?mzom3.Em_u8__m2_<_m:mmmn I.>822.82_u::Qm”EEmmmsrm~t_o§.ooEmmcmm:mnuqouzm?ma2:Em§o_.mo.. zo.<<_Ew.m:qEmm:<EEmno:_mEmQEE_m>9mmEm:~8EmoozqmarEmmmamwcsmm?m?mzamsa mo_3o<<_mmnmEm.mmo:um:<_mmcgmo?8>:_o_mX.mmo2EmOo_o:mmoOo:w=E:o:3>mom_.V.$5ummzmmgo:9E83;8<_o_m.mEm83$mag~mn::m3m:82._.>wO_»3Emmxmoczos2Eww >©?mm3m:._=_mSam68ommanmmqmmaEm"E_m>9mmEm:.aomw:2oqmm»mmE:..=mom_<mmqQ.mm» 0...2930.qmg9oc__mmzo:<<_EEEm3mm:Em2#60.»mam.:o2<_Em.m:a_:mm:<EEmEE8 >9mmEm:.<Oo:.:.mo~8Emooszmarm__vm<3m3oc_6m:o:m9.Em05mmmx§mmm_<qmumzmmz.msaoosa.8:3Ego:Emoo3E:Ecm<m__mw__=<383mm_um<o_EEm8::2EmO=<_mo::m32mom_umzoq m:aEmcum:EmEmmam:oommaEmUmomEcm?3.mEm:o_m_ogamzozm2Em0.2vm<mEmmamaEmoczma:mom_<mm?mamoo:.Emm:.E8:33%..2E2uc?ommcmEmmuuaovzmmmg3338..mam 38m:m_msBon__um:¢2m<_msemsoa.9.03%mo._8.83seeBmmmoo€s>z.m:m_m<<oommo<.o6 nmm3u~wm:m<m,.<Em}_=§.c,.,m:.m2USED Page 172 of 319 X. oEm2<_mmEmmmm<m__mc_mEmoooamzom§EEmE_mm..mm:_m._o:m.mam.mmo_:._o:mo.EmO_.<mag mvm__omU_m_m<scum:Em.m=Sm.omE¥ou._m.m£5:33%.E_m>m.mm3m:.m:m__cmumm3mn_ .m.3_:m.mn_.._.:m03.m:m__.33ma_m.m_<:o._.<Emoo:..mo.o.o._.mmmmasmmo.mcosooocnmsomEEm m<m:.9.man:.m::Em._o..__ Ecam.mmUmammm”Em05.magoo_._..mo.o..moou:_NmEm.._Bmao.Emmmmmzom3Ea>m.mm3m:.vmomcmmo.Emv:c__o_:.m.mm.EEmm_Emammm.m.<_magEm.Em05.<<___222._:m:o_m__omm_mza _:oo:<m:_m:om__.Em<<o.xmmso.oo3u_m.m<<_E_:Em._3mmnmoama3Emcamooc3m:.m_Ecmm:<mx.m:m_o:mEm.mo.m__o<<mmEmnooamzom<<_EEm®m:m.m_oo:m_._o:m..2.m<m_moamoomawmEm mm_m<m.mxumzmmmsaa_3oc_..mmE<o_<mo_Eu8<Em_Em_mmm_c8mmmm_:m_Emmo.:m__ommm:...m.maE. EmO_.<_.Em<<2x_m:o.oo3_u_m.moz._3m.>oooaEm_<_Em.mmao..mg:_.5m:<mac:900..EmO_.< man0o:..mo.o.muqmmEm.mm_§cEm.maQm3mmmm.9..._m_m<.cc.so.mmmum:m_.<_Oo:..mo.o.m:m__vm< EmO5.383.mmozam<Em.mxu:mmmam.Em._3mmnmoimm.9m:cm.m:._m_oo3u_m._o:c:.__Em <<o21moo3_m_m.m_mag8.8.2mmo:qm<Em.mxv_.mmmam.Em._:._mmumosma.o1Em_oo3_m_m._o:::.__ Em<<o:A_w.Em__<oo:._n_m.m. >mm_m:3m:.”Oo:..mo.o.m:m__:o._m.m:<._3m.mmmmc:m3.E.m.mm.EE_w>m.mm3m:.o.EmoEm. Oo:..mm._uom:3m:.m.om:<umqwoso.m:.=<<<_Eo:.Em.53<<._..m:ooswmz.o.EmOE.mumom__< Eo__.a_:u.9..<<_Eo:._3_.m._o:_3o:m<mEm.3m<_mmoo3macmmza3o:m<mEm.m_.mmcm3m<so.am mmmazmq<<_Eo:.mcosnosmmz.Amxomu..oEmmx.m:.Em.Emm..mo.o.E_m.mm.._o..o:3m<cm__3_.&E._m<<v.>3m..m3_u.mmmwm_m:3m:.sE_o:_m:o.Eoo3u=m:om<<_EEm.m.3wEmqmo.mEm__mm:c__mzm <oE.C:_mmmmvmo_._om__<m.m.mQ.oEmoo:..m.<Em:<<<._..m:oozmms..0ms>mm6:3m:.‘so>m.w_m:3m:. <<.m_mmmmo.a_mn:m6mEm>mm_m:o..83m3.9%o_..mm.oo:m__m<czmm.EmOosimo.Uoo:3m:.m. Oo:..mo.mEmEm.“_.Emm.mmaEm.E_mOozzmo.m:m__cmEzesmonmaEcam.oEmcm:m._.o.Emumamm:m.m.o_Em:Em_.m.mxmo:.o.m_mm3E_w..m.o.w_mmmasm.mammcoommmoa. m.m.mm.m.:.m”_.E_mEo_.mo._m.9m_o:.u__oE018u§.mo.o.n:_m__ou.o..mo._mm%._8._Ewmo._o:m.$._om§ o._m.m.Emmo:..mn.o.mEm__oo3c_<<<_.Em.:.::Ohm.sE_o:amnaqmmEmoo:..mo.o..ocmmm._mmm. m6:.<nmamz.aooxaOo_o.mao_mco..2m3._mc_m__oE018§o..mo..Em:nmQEmsEo_mo.Eum:3m.m.m. oo::._mm.moEoo_%3%_o.3::_o€m_3o:_mm. Oo:..mo.o.m®cmB:.mm”._.:mOo:..mo.o.m:m__o:m.m:.mmEm.<31»mammmmoo_m.maEoEm:.m_mm:m__ .m3m=._Emoon.o?m.mzaSum:.0.mumaoao.ozm.3<mm..83m__omcmmwmzwim.83am.mo._<m <<o._3._m:m:_umam3m.m1m_m.mza.oEmxmm__.mnm_.wm._mEm.83mmaomcmmm9:3mcoz_om._om<<_Eo:. .SEm.oo3um:mm._o:_Emqm.m.3_:m._o:o.Em:momwm=<.o_.Emqmvm:o..mv_mom3m:.o.mmau§.mo._ msmmmmoo_m.maEoEm:.m_mo.m:<uoao:Emqmonm:m__.mm.m:._.m_<<<_EEmU_.mo.o._um:Am_mmn.mm._o: W_.E.m2<<:ommamo_w_o:cum:Em3m..m.m:m__mm._:m_mamo.u__mm.o2cum:EmOo:..mo.o.. nnmimmmm. Socm:m_m<<ooa.um_..2<m<_m:u_m<<ooa.oo_o.mqomg88$ .83avmmoo<<<<<<.m.6_m<<oon_mo<.oE E;_3Eo§_m.._.u.o_mn.Page 173 of 319 <mx_m_n>:ozO...oo_<=u_._>zom<<_._.Io.x.m_m.3.m-::m?mmo.mmm>x_u_zm_.__m_zmO_u__._.mm>_. >_._mzm :3m3u_o<mmm.Oos?monoammsam..__8o::.mo.o_.m"Oo:Emo8?mg::9_So<<Eo_<m3u_o<2ooszmo?2:: ms___mmm_m__m:8um:o::<3}Eam?E_m00233.oo::mo8~mg::2ooaqmo?2::mm:_uoo:...moR:EBRaw 8omaé8Emoozzmo?o.Em:Emmccoo::mo§<<___:9_3o<<Eu_<m3v_o<2oo_._=m§2::ms___mmm_m__m:8 cm_8::So}5&2E_mOozzmowEmmm-:.m.3m?xmx_vm:3 :3<m_._2nm:o:_oo:.:mo.2<< _ nm:_mEm.nmEm_EmqEmm.<2_€_u8m:mE2EmUmvmzamz.9883.mm qm.EmQEohm.$3.3o._8.8magm.:.m;3G5qmmumo._<m_<.Eoamq88:33Emm3u_o<Em:.m_EQ 2m:m3_u_o<mmm5:0mm:m<<_<3:8*9m3u_o<3m:.n8vmuozsSo}Eam?E_mu:E_oooszmorOo::mo8q_m 9038.88:03:mEnEmm.<m:2U3m_.m32EmUmvmzamz.Eom?maEoomacqmm8:_a9.a_a§m.m3v_o<Em:. mQmm:Emo:.%%u_a%asE__mE_moozxmo._mcmEmumlozsma. A8USEno._.m....:Em.mmm§no=:%n:oo::mo8~oEm_:wmo8m__3o<<_mammEm:mw:Eoo:.:.mo.o~ um1o«3EmSo}csqmaE_mOo::mo__3o<<Eo_<m3v_o<mcaoo::mo.m5::ms___mmm_m=m:_EmOo::mo8«m:m__“ 339.?EmmcumozzmaoqmagEm0.?SEEE?mmam<mEm»EmOo::mo8?EmmmoEm_ _So<<_mQmmEm:Emmcwoozzmo?on_mm3c_o<Em9oozzmozso<<_Ems.mmm_m=m:“mam E»m«3Em.nmEmm:u.oo:Emo~<<_EEmm:wmo::mo8~:_<<_EEEamm35oq?mom_<Emzozom nmns?mgvcqmcmi8E8umamm?musEmwccooszm?oqaomm:2Eonm3v_o<Eo9oozzmozsc<<_EEm ___mmm_m__m:“mxmmn»Em:EmOo::mo8«m:m__:2_m3.Em.mEmoo:.:mo»<<_EEmmcwoozzmozz:Q:1:©mam:Emm35Emm:coo3..mo.2225$E8::m=o:8mm8c__mEEREmm:woo::mo8qEmmso. _3o<<En_<mEv_o<maowmo:=mQmg<<_EEm___mmm_m=m:. A39.23oo3u_<5::maa_:<mm:m_m:o:”Oo::mo8qmEm__oo3v_<SE22?mmmosmzm?mgcmm?2Em Oo_oSgoUmmm:3m2353.manm3v_o<:._m:.nEmamEEmoocam2msE<mm:@m:o:3Em,EmUmumnama_m::Qm:mxEunc?mcmi8o.m.m.m.i.m-3~A9. AmyUmimmmw:3w_.mmm:onOosrmnn._.:m92E383Em8E_mooszmo?8amEmma:9.83:5. sEo_moqEum?958Oo::mo8mmEmma:2m:<mmozozo2E_m839%:2u8<_m_o:m32:8wcqmcmz.8 o.m.m.m.:.m.8Noo:.:mo8?wEm__cm__mEmR:moEm_mamno:mmn:m::m_Qmamcmm8Em05Em.E=_o:8 m3.oEm1mcm_o?mo_:=mc_m~m3ma<Em0.238.mmm:E_mq82:mEmma:2E_mOo::mo:_:am1Em nm?mmqmcz. Boom:m_m<<ooa_um:o2m<.m:m_m<<ooa.oo_o$aomgEmma A88avmmoo<<<<<<.m:m_m<<ooa©o<.o6 OWQCVQMmm,._mSméum}::uS<n.Em_:_u§,mn.Page 174 of 319 _z<<_._.zmwm<<_._mxmo_u.Emumwzmm:m_.m3:m<¢mxmncnma=:m003252:5o_m<2;.<mm1:m:<_._:m: mco<¢. O_._.<O_umzorméoou msUm»? AD:mo8_.v w<_Um?m” 8.2_<_m:mmmc ws0&9 :<_m<o..V >._.._.mw._.” O5o_m.x \é0 oo:§o§an83ms:m3m Um»?.\N\‘V xzc.1m 23.3:35man«:23 38m:m_m,.<ooQ_um22<m<.m_.6_m<<ooa_oo_o$n_omo._3.83aceavmwoo<<<<<<.m:m_¢<<oonmo<.o6 onn3u,mmw:m<.,o.<vm}::bB<m__$:.m.3_,.mQ Page 175 of 319 mozmucrm> oc:._zmO_um._.>._._m_<_mz._.O_u<<Om_A ._.0m2mm>_. Oo:m_Eo:o:Oosomn?.So. ism_<_$aQ69 _.o:m3o3_Oomemo» 3o.3m.38 0.22m:m_m<<ooacum}?mmoqmmzozW_._§mJo Soc_m_6_m<<ooa_um12<m< m:m_m<<ooQ_O0mojo mxmocaos5.98323 N2>_<_mm.uxozmzczmmmm>2Um_<_>=.mO.”nmogmoaooo_“6_z>aomw En:m?vdmsSosomémm wmc_<__<_>m<O_uncmnommmommd?m_<_mzaom<<OmX Ooswzcnzosoqmmsmzmr<mc_.8:2.8.53_o_manmmuzmz:m__w. A.moc__u_<_mz+>20_umoom>_<__<__zo._.Omm_umo<_omow<o_._.<Eu>25 Z\> m.O._.Im_.».0O2mC_.._.>2._.mmmocmomm zozm m._ummom_3_ozomEomxnmoocoa>20om:<mm>w_.mw Oosmqcozoz2mmrmzmn<3:82%.amine_o»mzammvsmz:m__m_ Nm_umo_>_.amm_<_m___u>2< zosm 38mzeméooa_um:¢2m<_m:m_mEoon_oo_oEqomi3.33 808awmmoos2<<<.m:m_m<<ooamo<.o6 omQ:.u~mm:mSm.<Um:1En3<m.:m:Z.u3mmn_Page 176 of 319 m._<_OUmomU><_<_mz._. _um<3m:.3.osmnx o._u><_<_mz+mozmocrm 925.:U3Oosmczmi2:5mso}3mono?mzom<53Em3__o<s:mcm<3m:.mo:ma:_m.>__um<3m:_m8 Oozmczmz.m?moozzsamio:Oo:m:=m:_.mmm=m€_:mSm_um__<mBc_mm=<___mm8:mwmm”8::33m_um<3m3 m%3:_m._um<3m2mm:m__cm3%E8:O=<_w<$Em:oo3:3m._o:80o:m:=m:_Em:Em_um=<m$w_mm. _<___mm8:mm:m<mcmm:mmzmmma. _<_o:=._<_cue:m:u3_:m_. ,5.mozmocrm>20_umxmom_<_>zom_<___.mm+ozmm ._.:_mmo:ma:_m$3.2:3m36%gagmagumlozsmznm3__mm.o:mm81:m9255.0:mann_m__<mQ9.Em Um_.<mB_u_mm3Oo:w:_.B:.. Oo3n_m=o:Qm?m_<_m8:3.Ba 1.>oom3>zom>20ammjzonxoomocmmm 3._.OO>._._OzO_u<<O_»X_n>o__._._._mm mcum»m:=m__<m__o2:mSo}5.:cm02.2.283Oozzmo?oa2mm__m<_m<<_um:nm:m=ma3. 0.2§__n8<Em3m05mvmommag22...:mm:mnqmmm:32cmmuuqouzm?m.Emm__m<_m<<um;Eo__:<. _z<<_._.zmmm<<:mmmo_u.v?mcmz.man3mooo?mzom5::3m_u3*mmm8:m_mm2_omm>mqmm3m3umczmmzEm Um:_mw:m$83.8.8|.Emumamw:m<mmxmocnmg.:_mm§m3m:.n2<<o}mm2.:_m $22.mo O_...<O_umzo_.m<<oou_0O_:O_»>UO w<” Aw?zmpémv 3.2233 ._.=_m_ Um:m_ 38m:m_m,2ooa_um._¢2m<_m:m_m<<oo..._.oo_oEnoQ:38$ 808$~.m8os2,2<.m:o_msBoamo<.o6 omo::~mmzmsmzum}_3bS<oEm:_Fawn.Page 177 of 319 \W....ceN_nm\\m 3.2233 3.9WM?p§..v U29 88magmioou_um:2<m<.m:m_m<<ooa_oo_oSQomg3.83 808ammwoos2<é.m:c_m€ooaao<.o6 0193.3mm_,_m<:m..\tnus/._§§.3%:Page 178 of 319 iIZ7.’E7'5 0S9V‘LL9'6I- LuMo.Ig pgnea 1.0608 03 ‘s?uuds opemloo 139.113UOOBBQ179; ‘am ‘uononnsuoo -9 8691-'80rOl.6 uap?exg qogu roses 0:)‘ 1uouI5uo 1 mans pea szm 'au|‘szdaouog uononnsuo azoos-Lu-cos Janeuuaezs '3 dmu zuos 0:)‘|3!UU91U9O anuq ;uowaJ;g '3 0779 sadeosu?gsaa ope1o|o3 66£6'S£6"£0€ 00'699'£8V$ 00'I-ZO‘VVZ$ 00'00S‘L0€$ mos oo ‘poomal?ua an.X°8'0'd aaueuawgew |EI|O]_ope.Io|o3 6080'Z9Z'£0€ uapmu uoos zzoos0:)‘Anaamawwo opJeAa|nog ope:o|o3 Loo/_ 'ou|uouonnsuog napqagu OO'€ZS'I.8Z$ VL >->->->->-CE‘UC0> 00'V9L‘86Z$ 199.70-Id1U9W9/\°-‘dull )|J3d M9!’\9I|38 LI-0'1 l«'8l|3C||8 wau Jappra M01 wmddv J.ClWWd oo=zuoz ‘s 19¢!"-|91d9S =61-eaBusuadoma U0!19Il7q9.l.P°0M9I5U_=l swauzwo suondaox 0IIV>IIPage 179 of 319 F IVEFWH‘F MD) _._.w-._«.3.~ wm__m<_m<<_...2_._3u3<o3m:»_u_.o._mn» m_u_umo_uom>_._uO_~_<_ ...c2.E<_mz..>_.mn_._moc_.mO."cz_._.uanmm xmn:__,ma8_21___8_9:mm.8:c9Emnozim?Qon:3m_.:m. Z>_<_mOm_u_W_<_unosmadngoznoznmunm.Han. .83UmmozmzosEca._u_._om rwanmomum O_mm::umanoaccsumm9 _._m:=:omU_moomm__.O<9 mmsom:u_mm:8_._u9 mammsom_._u9 9-32._.__<_>o<mq9-30:mcccmwm39 00356.9.30:$9:mm9 >mo_Qmmmm39 ._.oumo____3uo:maO<9 mo:FmumqmsozO<9 m8_mm9 _:._cm:o: mm...E332_um_oo:«~08.A_£-_uo-mmV”E__-o=o_m_m>9 m..m_:_mmmmama. <<\3»ZoNN_m _»m_:9383_um_oo:mos.A_£-vo-mmxum_4-o=o_m.m>9 m8_:_mmm?ow. <<\EmZoNN_m mm...mamoi_u_cmm>_<__u_»maoE+mom>_<_mmmx_..c__m>9 0.86m8_:_mmmm..mm_ mm...93moo..._u_:mm>_<_vmmaooA+_uom>_<_mmmvHm>9 _um:O_8_mm.B_:_mmmmag 88m:n_m<<ooQ.um:2<m<_m:m_m<<ooa.oo_oBaomo.8-83 308Swuuoo<s2<<.m:u_m<<ooaoo.o6 m Page 180 of 319 H’ mm_:93.._mom-m>_<_-_u_»m _uou-cum_o_.m<<<\<m_..ZoNN_m 1 _u_mm:o_u__omA_.m~m$_vim man_u_:_:mmv A:O_mmmBo _u<O Am_$<£ 4..mm?w_a m_wo3o oo:=o_<m_<meumwmagma 4..Om?m<m_<m 1 O:_ox-Oocu_ma<m_<m§o__a8 misc _.o_3mag <m_<m use Oo:=o_<<:mMA<o=3-2.5 m> Eu Eu m> m> m> _._n $€9€B~€969€B ._.=_m003325.:ammémima3=5_o<<mmn3=ma_m.3muo:m.<m25 _.amuo_._w_a_oaaa?. Boomzgméooa_um:c2m<.m:m_m<<ooaoo_o.mao 2:8.83 avmmooszszm:m_m€ooaoo.o_.m ._.O._.>_:>_<_OC2._.omm__.u3 zojw Uzommm:m__63E:5 ammo”Em Em 3 Em ooiqmow ox>QQm:QmZom.W moxzoimqmmq.Page 181 of 319 Page 182 of 319 _uon_:..o::m.._o:$_m:<m 368 Emmmm8319 Z m3m _um3m_mno3m=mmm ._.=_mmm:_o.._umq_AEmzzmq >Qn=mmw 83 mc=.<mG#<><m\nm:8::_m_.no 2:3 88m_..m_m<<ooa_um1c2m<_m_.6_m<<ooa_oo_o_.mn_om38.83 808umvmmoo<s2<<.m:m_m<<ooaoo.o6 m H...mL.ToSmm:n<..mz mun:Hauno<?...o=n mnoum Page 183 of 319 Page 184 of 319 5.E3<053&3oncxu?oimnmomum?maa2.95oon?mo? wmox:0.acanado?3:»=2 5.mxumamsoonO:mmonmnm?o302.=m.nvaowoo?58:9_oom:o=.38oo:6_o.8a.ca <w_:o.mam: oon?mo?<m_:a.aomoanmonomScanooBEo8m.BEoosnmo?38¢mamE52».:E:co_..3250 8 Emma 93¢38.00..83338ooBEm8a3:8:5»m<ov?ma. mam>:mo_._ma 3.DoV5:233%mccoosnmomsmScan:39.eaoo=.Bmo$<mm mo i.<8.2:3@222:8.83:823%.x.Ba8s&oB.~ x.=.m3mxom<m.._:o._<___mI6:Oo:m:co:o:Aoozoqm?mv Hm.wmowmaocsaBEoxuoaonom9.5oE532Boaconm2,v.oE.oammammmos2:0 <1:cmm=<o_<ma 5sawE.o.wmo.n mxamazon 3 <mma Zmao?an En:wqmvam:_u3_.m2_<_m:mmm« 88m:o_m<<ooa_um:2<m<.m:m_m<<ooa_oo_o_.mao2:8.83 808awmwoo<s2<<.m:n_m<<ooqoo.o6 :m.3.o3mm__m<_m<<3;_3u_.o<m:._m3 c.rssamaaamimmam..“Sa\o~Emv?ownEm...m:mo<m_.=Bo=.Q.mmonowcaowmo?mE:8 5%25 AB <33 «<53 _EcEm8a n?ammomSwan 9.83.an5&3.£53 m=cmS=mm_&%=§oa E.o.8m»m oooE.Ba owBa 2593.ooocnasm.>23:axEm:m3o=5 33:.zozm 2o 3.Em<o V5:o<oa 3:8 8 ooBEo8m3.Scan 253%V55 cwmmo<oBBoRmmonovxw Exam.5503 ea 23% ....Eomzmmaon 8 >8 V5:roanmonmmBE.:o6m_oo3Bo3_.2.Ed.9:9.3:3 €32 EmmmBE ::B_uo~.~ ._OO> m.mason:Qua owScan 332:3 .3.V5: Om:m$_oo::mo::n_Om6m::< zo__.Im<m V5:o<a~.§,§=8 3 com:.8:3=w.8m on m8=§§23.mmo<m3Bm=Hmmoaovxw S.E58 wan ¢<mm Ea ooa?m?3:3:Page 185 of 319 Page 186 of 319 B..55 cnamammsmaE33m?ronnomBE EncnmaSQ waaoa.93.o_.oonuonmmos893$:85. 33333:§_=8a._3.:5 O5.5 <m1mcm:o:omEa _.oo:m_mnoauammsmEamS.8Bo=..owEn?omm ncwzmommosm...\ Uw?B ..k K ..\\mm nW\\.3 Um?ow H .no N M mu: ax 3:2 2245 .229 givmm. 88m:m_m<<ooq_um:2<m<.m:o_mEooa.oo_23omo._8.8.3 69:avmmoo§2<<.m:m_m<<ooaoo.oB 2.325mm__m<_mE3:,_3...:.o<m3m3u_.o_mn~Page 187 of 319 >n0aDom_?__u_o>._.mom_._>m__.=.<_zmcm>zom_.2.523 rI\ml.\MoH4 ..=__mom_£.__u_o>..m_m_mmcmu>m>_s>d.m_»on_z_6w_s>.._ozO2_..<>20nozummm20361.3C102=._mom_»._.__u_o>._.mzorumm....:_m .mw..._u_o>._.mcoma20...>_?_».__>._._<m_.<O.»zmo>._._<m_.<>:mzu_mx._.mzuO.»>_.._.m_»._._._mno<mw>om>_"_6_6muw<._._._mvo_._n_mm m_.oE.._._.__uom_£._m_n>..mon_zmc:>zomcomm20...nozm.:_.:._.m>ooz._.w>o._.um._.Emmz._._._m.3529_zu:wm2$.>c._.:ow_Nmu wm_.wmmmzq>._._<monVNOUCOMN.>20._._._mnmw:m_o>«mzorumw. __suo_s.>z.."=_=583:883050.._uM:>uu=_oz>_._zm:zmu.=5uo__n1_oa.5::do2ao_a2_.=mcmmoo>.=oz_m<<>_<mD.a:Ew3 8 So8...:2:.oo:nEo:a2.Souo=o<.oo_.B_:oo__n_8_:m<_da:_3m:o.=.o_do.=o_.=.>o?noiosn2.9...93:8noon:3333...._u..B 8 5 35:88=0..._._:=2.32.2.o=no_aa=_o=a. vxoucomwz>:.Nm?owmmmnmnm m£.._.5D..H.mm<n_.nnH?mc?m?omvnm?o?.Hun.1:zm.G4393Lama .83nwuxmmmmmwmmwHW£w<.:u>=.._nmHoHmum.mnmHm@Hmm<”_.nn.00B mcwnmHow ....o<mHmbmnomemum_zn:nmn>"nu.5o“_.n5mnHHvmnnmbomno _zu:xmau"E.n5mooHurmmc?m?om _zu__ama9»nHmun..ommnn_.wHnHumn?mbnm Eucwmu no?mn?cnnwohnobnomzumHan p?bmsownmnnmmn _zuE?amu H.o5m.Bounnomomon oo<mz>ommom_?.._"_o>..mzczmmwu?uHmso_~m<_m_ozzssuman ._._.__m_m._.Oomm.:_u<41>...._.Im_uo_._o_mmO_u_zmcm>zom_._m4mommroé_._><mmmmzamcmo._.O._.Im_zmcxmoz>_smo>mo<m_uON.:._m_uO_._O<nmaoo _zo_o>«mo.zo4<<_.:._m4>zo_zo>z<mmoc?mgmza.amasO.»oozo_:ozom>z<0024.890...O.»oqzmmooocamza<<_._.Immmnmoq._.O <<_.__OI .25 om_3.__u_o>4m.<_><mm_mmcmoO.»_s><_um_?>_z_._.Im_zmcm>zom>mmoxomo3.:._muo:o_mmommoammo_._mmm_z_mmcmzmoq._.O>_._.._.Im amm_sm_ mxo_.cw_ozm>20oozo?ozmO_uMCOI_uo_._o_mm.E_<=._.mm_._o<<z_<_><:><mmmmzxmocomum<_u>_oO—.>__<_m. _u.m_u...<_.mou_zu:a>zom .no. ..o:n<zssmma Eno..:mwn_>_.o!ma>_._._>u__._._.<mmmoumnumm__.o\H\MoHmHo\H\noHq I.o_.>_z_m._s>omEooocm Hmtg"wmmtuoumwH?udnmm H5.3Smwdmu.ommEuHo omz._.>ommmm>..m_.=s_a>u_u_._mmummomzmmz.>mommo>4m I_.o_._o<E.__um%+BSoumooco.a-oo_s3ou>00 Ioaxmm. >S.o:ou__.m:>m__._._.<E.mS$u$Ho\H\noHmHo\H\uoHqomw,n§ww.m_zo.:2:«?oo?ooo moo_r<_z.Em<AVE.umamozv »_o_+mom<zmummummcrmumoo__.<_z._cx<=6.mnnamasm >58_um..monaoa.zoz.o<<zmoumoummiu>.s>om Er.<<Om mumoum?mu52x8::<t8:m>o:ooocmmmznmm n.ooo.ooo Ior>__smé_>om>oommm>.:m N.oOo.ooo Emm._.mz:ozM Eo_.xm:uno:_.mzu>=oz831m4H3:.>2:mE..b<m.?._._>u__._._.<\\ <~z>z<_uxonx_m4oE_u>§zmEmxmoS_<mBupturn...amazononu H.ooo .oooomaomasmzmmmmxorcumo»mcvnounnwoum H.ooo.oooE2_:zs Umox=u._._ozonoumm>:ozm3.92mro_mm>mm...o:n<_.__s_._.u H ooo ooo=mu.aounadm5%. m??bmnm?ux..wmmounwum.$o-ow-ou-om-ooomuoxwxnowmwoxwxuowq>:<o=mm._.:n.c3§.8o._o&uH.moo.ooo ummnanuozono_.ma>._._ozEFOOuozu~<m:_nrmu$005.52:.>.a_.§s_3.03:9.....__.:_..3toB3»3=3pornoE..oa:_35 om_»._.__u_n>.:m:o_.umwn>znm_._.>:oz m_._OC_:U>2<on._.:m>mo<mummoaumu...o:o_mmumo>zom_._.mo wmmowm H02305HREEKOo?nm??._.:mmx_._z>.._oza>._.mEmzmom.20dOm<<=L..umum_._<mwmo .2 >noo_6>znm<54:._...__....1OEO<_..mo<_m_ozu. >=._.:O?Ewmunmmmz._.>.:<m HAWHOHGmmnmnmbgmmamxtb?lth‘ ®§=..»..=>026oow_.ow>:oz.>=_._u_._uBuoloa. >oowunu.»..._2o._.._..5>0263:32:..80E.»_.ou_o83._.:u.._6om>no_6 S34 Sumo M.:.m¢ G .Em?uuqb?n ..B >36au_za oo<ma>amPage 188 of 319 5-mug on (U ,3 TIVJSdVD|C|NVH (ll 'DN| 5319,,ND”(.ozI.un)sa:wassLu1l'l3l-IILSmv9(.EI3zl:9L 1°‘°"”‘'‘'‘‘“'”“5" taxvuzarlv-aov) Huomnv/x aanscmua mm NOLl.VJ.$.l3d 0 u 3%.‘° z \‘ nyg YEMQL USIHHVB9l WW N0|5N3-1 H-,_uy».goa9aa H9IH‘X3 'Bumvwau01O3P°°M9| “‘’°'‘‘”’J.OE|f‘OE|d J.NE-IWEI/\O?:ldW| ‘Wall-N“-OCIIIJVIIIIINVU-9-‘I93 4I0w"\N“Ol5I°"T|P?'-'?I°)1|"|I'°l'~!3°I?AI-Imn-a&o|50lJ)PN‘P'HP°|“DN-NF)uudunpasnqpun Lunxnunnkomuuqpncpvnruflpu-DP) -.ux.o9:up'=n«?-swauanipalu-nlnnuln-«luv Iwmswvwrunw?vmwu?owum um-Inupumnhnnlnwnm-av-Mm wnsrnaapdunqum Iqumanuopom/upuuun&¢uu‘u-upaspoubuu (E)3W'13!‘-“Id ('|'W'3N‘PPV).Sll.Z||°|I°1.|9'WIU3$?‘Z .0Zl.E|i"‘5°P|-'3Pll°J.”‘?'!.lZl.9l‘l'lP|lS'43N'N'9 Page 189 of 319 32., mouiiauI31ma?a? wocwnouas35% wo<E.:o 5.m..uo<u33m3m_ 00.52miau?x 08:203:. was08.: room.03:. ._.oB__:$aq<m3:.oam_ Z25<wa5.o3Sooaoman092. ?ea:m2.5§ O59._u__..m:n_:nmocaou ?ogmo=:...ouonmcauu tmwm2m§& m§.2i==3u o:_E_.m_manx$_.8.§. Non:m.ie:&E:ra O52...._=m:n_:ucumm ?ea:tunao:n§% 23mccwnoa«tuna»o2..§& maniaISAmm?aoo _..§._wm?aaovmamamnmOrmzoo m?iuue?nanneahos. _u3_o?oo3u_m=o: 955..mvu..o<m_ canntzizunon35% . _H_moE6mm 2:» >39: ..u3.~uuM 85: BS! Sauna 3.2: Spas Spas Nahum .393“ «meE .%.=t ._.u3.§u :3: A.96.»: Spawnm 3.... >3». 53.8:a air a98o SEE .33 898» 39.3» £98m 5.8m tuham 89%» ._.a.3.8.0 Nuhm? ..a$.m8 8n.u.Bu c lmsa wm_m:om Me:3:83 >33.>023‘>35 $3.2:. £3.89 . 33.3»g u 23.3 H mmsomo «aqua .§...§..233 898°mS.o8 .3930 um25 ..umu.8o ..u=.~&..3m.m~u Si»: 93..ummm mum...8.8.. ._.u8.muo ..u3.8._..§...§ ._.u8.u8 ..u~o.8._._.§...a._3955 89...»:398.. e?pma 23.3»..ma.m:22.8 2.u..8o ..§..u=.939.3»..u.a.m.:Spas n.398_.?mboo ‘.30En ._ .:._..=»..u&.m.:Q.So So 8..Eu 8.. 2%:.=.§3.3..IEIE .8.§ ...§.§«2 £3 .23%:?ag «§.§ Lm.an.\..3 {So .98.:awe»:cubes 4.$m..8 ..t~..am §.n....~.... 5.8..«momma»u 838 «SSE Q m 838 9.3133..353 man_.».mo«mm:o: _u::..._Cum:mumom3:5 Sources and Uses m.m8.o8 ..mmo.o8 ..u8.o8 88.8 »S u >oEm_ m.m.o=.o:.om«Ea mocnoom.cmommannznamam.:_uEE mm_m:no 33 >35. oumzm_u>om mczo no: >oEm_ no.u >nEm_ no.m >oEm_ no: mm=:._m8 no._u 95%. n.8o.o8 ..u8.o8 ..o8.o8 898° 0.22 m:m_m<<ooa.oo_o_.mao _u§.83 mcuoma23Page 190 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: John Kuosman DEPARTMENT: WWTP DATE: October 16, 2017 SUBJECT: L/E WWTP Strategic Operating Plan (SOP) DESCRIPTION: L/E WWTP Strategic Operating Plan (SOP) RECOMMENDATION: The Littleton / Englewood Wastewater Treatment Plant (L/E WWTP) Supervisory Committee and staff recommend that City Council approve, by motion, a professional services agreement with Carollo Engineers, Inc. to conduct the L/E WWTP Strategic Operations Plan in the amount of $500,000. PREVIOUS COUNCIL ACTION: Council approval of the Littleton/Englewood Wastewater Treatment Plant (L/E WWTP) 2017 Budget. SUMMARY: In 2017, a line item in the Capital Improvement Plan budget was included to evaluate plant modifications that would be required to address tighter limits anticipated in the new L/E WWTP discharge permit. The new limits are primarily tied to Colorado’s Water Quality Control Commission (WQCC) Regulation (Reg.) 85 with a focus on tighter control of phosphorus and nitrogen. While Reg. 85 is critical, it represents only one factor that will influence our facility moving forward. Planning beyond just Reg. 85 is necessary, and as a result, the Strategic Operations Plan (SOP) was developed. The SOP is intended to provide a road map to achieve operational excellence, manage critical assets, and identify capital improvements needed over the next five (5) years. The SOP will address: • Phosphorus and Nitrogen requirements of new Colorado Discharge Permit System (CDPS) Permit (to be issued late summer/early fall 2017) o Physical/chemical treatments o Centrate treatment • Highest risk of aging assets and infrastructure o Preliminary treatment processes o Solids treatment processes o Electrical systems o Underground infrastructure o Other aging infrastructure and buildings • Operational challenges; maintenance and staff resources Page 191 of 319 o Struvite o Snails o Solids treatment processes • Chemical and energy intensiveness of processes o Denitrification o Disinfection o Solids treatment processes • Resource recovery opportunities o Phosphorus recovery o Nitrogen recycle o Solids treatment processes o Standby treatment capacity ANALYSIS: Staff initiated a request for proposal (RFP) process to identify the consultant that would develop the SOP. The RFP included requirements for consultant qualifications and relevant project experiences, as well as other criteria, for the evaluation and selection process. Seven consultants were pre-selected and invited for proposal submissions. • Brown and Caldwell • Carollo Engineers Inc. • CDM Smith Inc. • CH2M • Dewberry • HDR Inc. • Stantec-MWH Global A total of seven proposals were received, and based on a review and scoring criteria, three firms were short listed for interviews. The firms selected included Carollo, HDR, and Stantec/MWH. Interviews were conducted on July 26, 2017, and following an additional scoring evaluation, Carollo Engineers, Inc. was selected as the recommended consultant to conduct the SOP for our facility. FINANCIAL IMPLICATIONS: Funding for the professional services agreement with Carollo Engineers, Inc. to conduct the L/E WWTP Strategic Operations Plan in the amount of $500,000 is available in the 2017 Major Capital Improvement Plan Budget. The approved 2017 budget for the WWTP included $2,000,000 for Capital Projects. Through September, $703,132 of Capital Projects have been expended to date and there is adequate funding available to fund the portion of work that will be completed in 2017. Funding for remaining work to be completed in 2018 has also been identified within the 2018 budget request. ALTERNATIVES: None identified. CONCLUSION: The SOP will establish an implementation roadmap, aligned with organization's strategic direction to achieve operational excellence, manage critical assets, and identify capital improvements needed over the next five (5) years. In addition, it will allow for better planning and investment in the higher cost improvements needed beyond the 5-year planning period. Page 192 of 319 ATTACHMENTS: Carollo Contract SOP Presentation May 18, 2017 Supervisory Committee Meeting Minutes September 28, 2017 Supervisory Committee Meeting Minutes Page 193 of 319 §;=Eri*§iewoocrPROCUREMENTDIVISIONPROFESSIONALSERVICESAGREEMENTcontractNumberPSAI17-25StrategicOperationsPlanforLIEWWTPS500,000(nottoexceed)ThisProfessionalservicesAgreement(the‘‘Agreement')ismadeasofthis17thdayofAugust,2017,(the‘EffectiveDate‘)byandbetweenCarolinEngineers,Inc.,aDelawarecorporation(“Consultant”),andTheCityofEngiewood,Colorado.amunicipalcorporationorganizedunderthelawsoftheStateofColorado(‘City’).CitydesiresthatConsultant,fromtimetotime,providecertainconsultingservices,systemsintegrationservices,dataconversionservices,trainingservices,and/orrelatedservicesasdescribedherein,andConsultantdesirestoperformsuchservicesonbehalfofCityonthetermsandconditionssetforthherein.inconsiderationoftheforegoingandthetermshereinaftersetforthandothergoodandvaluableconsideration,thereceiptandsufiiclencyofwhichareherebyacknowledged,thepartieshereto,intendingtobelegallybound,agreeasfollows:1.De?nitions.Thetennssetforthbelowshallbedefinedasfollows:(a)‘intellectualPropertyRights‘shallmeananyandall(bywhatevernameortermknownordesignated)tangibleandintangibleandnowknownorhereafterexisting(1)rightsassociatewithworksofauthorshipthroughouttheuniverse,includingbutnotlimitedtocopyrights,moralrights.andmask-works,(2)trademarkandtradenamerightsandsimilarrights,(3)tradesecretrights,(4)patents,designs,algorithmsandotherindustrialpropertyrights,(5)allotherintellectualandindustrialpropertyrights(ofeverykindandnaturethroughouttheuniverseandhoweverdesignated)(includinglogos,“rentai'rightsandrightstoremuneration),whetherarisingbyoperationoflaw.contract,license,orotherwise,and(6)allregistrations,initialapplications,renewals,extensions.oontinuations,divisionsorreissueshereofnoworhereafterinforce(includinganyrightsinanyoftheforegoing).(bi‘workProduct”shallmeanallpatents,patentapplications.inventions,designs,maskworks,processes,methodologies,copyrightsandoopyrightabieworks,tradesecretsincludingcon?dentialinformation,data,designs,manuals,trainingmaterialsanddocumentation,ionnulas.knowledgeofmanufacturingprocesses,methods,prices,?nancialandaccountingdata,productsandproductspeci?cationsandallotherIntellectualPropertyRightscreated,developedorprepared,documentedand/ordeliveredbyConsultant,pursuanttotheprovisionoftheServices.2.StatementsofWork.Duringthetermhereofandsubjecttothetermsandconditionscontainedherein,Consultantagreestoprovide,onanasrequestedbasis,theconsultingservices,systemsintegrationservices,dataconversionservices.trainingsenrices,andrelatedservices(the“services")asfurtherdescribedInscheduleA(the‘StatementofWork")forCity,andinsuchadditionalStatementsofWorkasmaybeI000EnglewoodParkway,Englewood,Colorado80110-2373(303)762-2300wvvw.engla'woodgov.on_;r-Mmar.:..m..;m,........r-our...rms..Mui:wwnvPage 194 of 319 exeoutedbyeachofthepartiesheretofromtimetotimepursuanttothisAgreement.EachstatementofWorkshallspecifythescopeofwork,speci?cations,basisofcompensationandpaymentschedule.estimatedlengthoftimerequiredtocompleteeachStatementofWork,includingtheestimatedstart/?nishdates,andotherrelevantinformationandshallincorporatealltermsandconditionscontainedinthisAgreement3.PerformanceofServices.(a)Perfonnance.ConsuitantshailperformtheServicesnecessarytocompleteallprojectsoutlinedinaStatementofWorkinatimelyandprofessionalmannerconsistentwiththespeci?cations.ifany,setforthintheStatementofWork,andinaccordancewiththeprevailingengineeringstandardofcarebyexercisingtheskillandabilityordinarilyrequiredofengineersperformingthesameorsimilarservicesintheStateofColorado.Consultantagreestoexerciseprofessionalism.andtoutilizeitsexpertiseandcreativetalentsincompletingtheprojectsoutlinedinaStatementofWork.(b)Delays.ConsultantagreestonotifyCitypromptlyofanyfactor.occurrence,oreventcomingtoitsattentionthatmayaffectConsultant'sabilitytomeettherequirementsoftheAgreement,orthatislikelytooccasionanymaterialdelayincompletionoftheprojectscontemplatedbythisAgreementoranyStatementofWork.SuchnoticeshallbegivenIntheeventofanylossorreassignmentofkeyemployees.threatofstrike.ormajorequipmentfailure.TimeisexpresslymadeoftheessencewithrespecttoeachandeverytermandprovisionofthisAgreement.(c)Discrepancies.ifanythingnecessaryfortheclearunderstandingoftheServiceshasbeenomittedfromtheAgreementspeci?cationsoritappearsthatvariousinstructionsareincon?lct,ConsultantshallsecurewritteninstructionsfromCity'sprojectdirectorbeforeproceedingwiththeperformanceoftheServicesaffectedbysuchomissionsordiscrepancies.4.invoicesandPayment.UnlessotherwiseprovidedinaStatementofWork.CityshallpaytheamountsagreedtoinaStatementofWorkwithinthirty(30)daysfollowingtheacceptancebyCityoftheworkcalledforinastatementofWorkbyCity.AcceptanceproceduresshallbeoutlinedintheStatementofWork.itCitydisputesalloranyportionofaninvoiceforcharges.thenCityshallpaytheundisputedportionoftheinvoicebytheduedateandshallprovidethefollowingnotificationwithrespecttothedisputedportionoftheinvoice.CityshallnotifyConsultantassoonaspossibleofthespeci?camountdisputedandshallprovidereasonabledetailastothebasisforthedispute.Thepartiesshallthenattempttoresolvethedisputedportionofsuchinvoiceassoonaspossible.Uponresolutionofthedisputedportion.CityshallpaytoConsultanttheresolvedamount.5.Texas.Cityisnotsubjecttotaxation.Nofederalorothertaxes(excise,luxury,transportation,sales,etc.)shallbeincludedinquotedprices.CityshallnotbeobligatedtopayorreimburseConsultantforanytaxesattributabletothesaleofanyServiceswhichareimposedonormeasuredbynetorgrossIncome.capital.networth,franchise.privilege,anyothertaxes,orassessments.noranyoftheforegoingimposedonorpayablebyConsultant.Uponwrittennoti?cationbyCityandsubsequentverificationbyConsultant.Consultantshallreimburseorcredit.asapplicable.Cityinatimelymanner,foranyandalltaxeserroneouslypaidbyCity.CityshallprovideConsultantwith.andConsultantshallacceptingoodfaith,resale,directpay,orotherexemptioncerti?cates.asapplicable.6.OutofPocketExpenses.ConsultantshallbereimbursedonlyforexpenseswhichareexpresslyprovidedforinaStatementof1000EnglewoodParkway.Errglewuud.Colorado80110-2373(303)762-2300www.eng|ewoodgov.orgm/t'l-:\Swanku,.s...a..r.nwmigsa-Kerinuswww-Page 195 of 319 WorkorwhichhavebeenapprovedinadvanceinwritingbyCity.providedConsultanthasfurnishedsuchdocumentationforauthorizedexpensesasCitymayreasonablyrequest.7.Audits.ConsultantshallprovidesuchemployeesandindependentauditorsandinspectorsasCitymaydesignatewithreasonableaccesstoallsitesfromwhichServicesareperformedforthepurposesofperfonningauditsorinspectionsofConsultant'soperationsandcompliancewiththisAgreement.Consultantshallprovidesuchauditorsandinspectorsanyreasonableassistancethattheymayrequire.SuchauditsshallbeconductedinsuchawaysothattheServicesorservicestoanyothercustomerofConsultantarenotimpactedadversely.3.TermandTermination.ThetermofthisAgreementshallcommenceontheEffectiveDateandshallcontinueunlessthisAgreementistenninatedasprovidedinthisSectionB.(a)convenience.Citymay.withoutcauseandwithoutpenalty.terminatetheprovisionofServicesunderanyorallStatementsofWorkuponthirty(30)dayspriorwrittennotice.Uponsuchtermination.Cityshall.uponreceiptofaninvoicefromConsultant.payConsultantforServicesactuallyrenderedpriortotheeffectivedateofsuchten-nination.ChargeswillbebasedontimeexpendedtorallincompletetasksaslistedintheapplicableStatementofWork,andallcompletedtaskswillbechargedasindicatedintheapplicableStatementofWork.(ll)NoOutstandingStatementsofWork.EitherpartymayterminatethisAgreementbyprovidingtheotherpartywithatleastthirty(30)dayspriorwrittennoticeoftenninationiftherearenooutstandingStatementsofWork.(c)MaterialBreach.IfeitherpartymateriallydefaultsintheperformanceofanytemofaStatementofWorkorthisAgreementwithrespetatoaspeci?cStatementofWork(otherthanbynonpayment)anddoesnotsubstantiallycuresuchdefaultwithinthirty(30)daysafterreceivingwrittennoticeofsuchdefault.thenthenon-defaultingpartymaytenninatethisAgreementoranyoralloutstandingStatementsofWorkbyprovidingten(10)dayspriorwrittennoticeofterminationtothedefaultingparty.(it)BankruptcyorInsolvency.EitherpartymayterminatethisAgreementeffectiveuponwrittennoticestatingitsintentiontotenninateintheeventtheotherparty:(1)makesageneralassignmentofallorsubstantiallyallofitsassetsforthebenefitofitscreditors;(2)appliesfor.consentsto.oracqulescesintheappointmentofareceiver,trustee,custodian.orIiquidatorforitsbusinessorallorsubstantiallyallofitsassets;(3)?ies.orconsentstooraoquiescesin.apetitionseekingrelieforreorganizationunderanybankruptcyorinsolvencylaws;or(4)?lesapetitionseekingrelieforreorganizationunderanybankruptcyorInsolvencylawsis?ledagainstthatotherpartyandisnotdismissedwithinsixty(60)daysafteritwas?led.(e)TABOR.ThepartiesunderstandandacknowledgethateachpartyissubjecttoArticleX,§20oftheColoradoConstitution("TABOR").ThepartiesdonotintendtoviolatethetennsandrequirementsofTABORbytheexecutionofthisAgreement.itisunderstoodandagreedthatthisAgreementdoesnotcreateamulti-?scalyeardirectorindirectdebtorobligationwithinthemeaningofTABORand,notwithstandinganythinginthisAgreementtothecontrary,allpaymentobligationsofCityareexpresslydependentandconditioneduponmecontinuingavailabilityoffundsbeyondthetennofCity'scurrent?scalperiodendinguponthenextsucceedingDecember31.FinancialobligationsofCitypayableafterthecurrent?scalyeararecontingentuponfundsforthatpurposebeingappropriated,budgeted,andotherwisemadeavailableinaccordancewith10mEnglawoodParkway.Englewood.Colorado50110-2373(303)762-2300www.eng|ewoodgoN.orgr.-wt»-.1Slutty‘:ll|Iu.lil\1\l'hAIiIl|Sri\inunuewim-Page 196 of 319 therules,regulations,andresolutionsofCityandapplicablelaw.Uponthefailuretoappropriatesuchfunds,thisAgreementshallbedeemedterminated.(flReturnofProperty.UponterminationofthisAgreement,bothpartiesagreetoreturntotheotherallproperty(includinganyCon?dentialinformation,asde?nedinsection11)oftheotI1erpartythatitmayhaveinitspossessionorcontrol.However,Consultantshallbeentitledtokeepone(1)copyofanysuchpmperty.includingCon?dentialinformation.thatConsultantusedandrelieduponinundertakingtheservicesrequiredhereunder.9.cityObligations.citywillprovidetimelyaccesstoCitypersonnel,systemsandinfcnnationrequiredforConsultanttoperformitsobligationshereunder.whichConsultantshallbeentitledtouseandrelyupon.CityshallprovidetoConsultant'semployeesperfonningitsobligationshereunderatcity'spremises,withoutcharge,areasonableworkenvironmentIncompliancewithallapplicablelawsandregulations,includingof?cespace,tumlture,telephoneservice,andreproduction,computer,facsimile,secretarialandothernecessaryequipment,supplies,andservices.WithrespecttoallthirdpartyhardwareorsoftwareoperatedbyoronbehalfofCity,Cityshall.atnoexpensetoConsultant,obtainallconsents,licensesandsublicensesnecessaryforConsultanttoperfonnundertheStatementsofWorkandshallpayanyfeesorothercostsassociatedwithobtainingsuchconsents,licensesandsublicenses.10.staff.ConsultantisanindependentconsultantandneitherConsultantnorconsultant'sstaffis,orshitbedeemedtobeemployedbycity.CityisherebycontractingwithConsultantfortheServicesdescribedinaStatementofWorkandConsultantreservestherighttodetennlnethemethod,mannerandmeansbywhichtheServiceswillbeperformed.TheServicesshallbeperformedbyConsultantorConsultant'sstaff,andCityshallnotberequiredtohire,superviseorpayanyassistantstohelpConsultantperformtheServicesunderthisAgreement.ExcepttotheextentthatConsultant'sworkmustheperformedonorwithCity'scomputersorCity‘:existingsoftware.allmaterialsusedinprovidingtheServicesshallbeprovidedbyConsultant.11.ConfidentialInformation.(a)Obligations.EachpartyheretomayreceivefromtheotherpartyInformationwhichrelatestotheotherparty'sbusiness,research.development,tradesecretsorbusinessaffairs("Con?dentiallnfcmraticn").SubjecttotheprovisionsandexceptionssetforthintheColoradoOpenRecordsAct,CRSSection24-72-101etseq,eachpartyshallprotectallCon?dentialinformationoftheotherpartywiththesamedegreeofcareasitusestoavoidunauthorizeduse.disclosure.publicationordisseminationofitsowncon?dentialinfonnationofasimilarnature,butinnoeventlessthanareasonabledegreeofcare.Withoutlimitingthegeneralityoftheforegoing,eachpartyheretoagreesnottodiscloseorpermitanyotherpersonorentityaccesstotheotherparty’:Con?dentiallntannetlonexceptsuchdisclosureoraccessshallbepermittedtoanemployee,agent,representativeorindependentconsultantofsuchpartyrequiringaccesstothesameInordertoperformhisorheremploymentorservices.Eachpartyshallinsurethattheiremployees,agents,representatives,andindependentconsultantsareadvisedofthecon?dentialnatureoftheCorrlidentialinformationandareprecludedfromtakinganyactionprohibitedunderthisSection11.Further,eachpartyagreesnottoalterorremoveanyidentification,copyrightorotherproprietaryrightsnoticewhichindicatestheownershipofanypartofsuchCon?dentialinformationbytheotherpany.Apartyheretoshallundertaketoimmediatelynotliytheotherpartyinwritingofallcircumstances1000EngiewoodParkway.Englewood,Colorado80110-2373(303)732-2300www.englewccrlgov.orgrsMi7.:.\in-ant:e,..m:.—iliunfngsmimlli.-izwwnPage 197 of 319 surroundlnganypossession.useorknowledgeofCon?dentialInformationatanylocationorbyanypersonorentityotherthanthoseauthorizedbythisAgreement.Notwlthstandlntheforegoing,nothinginthisAgreementshallrestricteitherpartywithrespecttoinformationordataidenticalorsimilartothatcontainedintheCon?dentialinformationoftheotherpartybutwhich(1)thatpartyrightfullypossessedbeforeitreceivedsuchlnfonnatlonfromtheotherasevidencedbywrittendocumentation;(2)subsequentlybecomespubliclyavailablethroughnofaultofthatparty;(3)issubsequentlyfurnishedrightfullytothatpartybyathirdpartywithoutrestrictionsonuseordisclosure;or(4)isrequiredtobedisclosedbylaw,providedthatthedisclosingpartywillexercisereasonableeffortstonotifytheotherpartypriortodisclosure.(b)Know-How.FortheavoidanceofdoubtneitherCitynorConsultantshallbepreventedfrommakinguseofknow-howandprinciplesleamedorexperiencegainedofanon-proprietaryandnon—confidentiaInature.lc)Remedies.Eachofthepartiesheretoagreethatifanyofthem,theircf?cers.employeesoranyoneobtainingaccesstotheConfidentiallnfonnationoftheotherpartyby,throughorunderthem,breachesanyprovisionofthisSection11,thenon-breachingpartyshallbeentitledtoanaccountingandrepaymentofallpro?ts,compensation.commissions,remunerationsandbene?tswhichthebreachingparty,itsot?oersoremployeesdirectlyorindirectlyrealizeormayrealizeasaresultoforgrowingoutof,orinconnectionwithanysuchbreach.Inadditionto,andnotinlimitationoftheforegoing,intheeventofanybreachofthisSection11,thepartiesagreethatthenon-breachingpartywillsufferirreparableharmandthatthetotalamountofmonetarydamagesforanysuchinjurytothenon-breachingpartyarisingfromaviolationofthisSection11wouldbeImpossibletocalculateandwouldthereforebeaninadequateremedyatlaw.Accordingly.thepartiesagreethatthenon-breachingpartyshallbeentitledtotemporaryandpermanentinjunctlvereliefagainstthebreachingparty.itsofficersoremployeesandsuchotherrightsandremediestowhichthenon-breachingpartymaybeentitledtoatlaw,InequityorunderthisAgreementforanyviolationofthisSection11,TheprovisionsofthisSection11shallsurvivetheexpirationorterminationofthisAgreementforanyreason.12.ProjectManagers.EachpartyshalldesignateoneofitsemployeestobeitsProjectManagerundereachStatementofWork.whoshallactforthatpartyonallmattersundertheStatementofWork.EachpartyshallnotifytheotherinwritingofanyreplacementofaProjectManager.TheProjectManagersforeachStatementofWorkshallmeetasoftenaseitheronerequeststoreviewthestatusoftheStatementofWork.13.Warranties.(a)Authority.Consultantrepresentsandwarrantsthat:(1)Consultanthasthefullcorporateright,powerandauthoritytoenterIntothisAgreementandtoperformtheactsrequiredofithereunder.(2)theexecutionofthisAgreementbyConsultant,andtheperiormancebyConsultantofitsobligationsanddutieshereunder.donotandwillnotviolateanyagreementtowhichConsultantisapartyorbywhichitisotherwiseboundunderanyapplicablelaw,ruleorregulation;(3)whenexecutedanddeliveredbyConsultant.thisAgreementwillconstitutethelegal,validandbindingobligationofsuchparty.enforceableagainstsuchpartyinaccordancewithitstenns;and(4)ConsultantacknowledgesthatCitymakesnorepresentations,wanantlesoragreementsrelatedtothesubjectmatterhereofthatarenotexpresslyprovidedforinthisAgreement(b)ServiceWarranty.ConsultantwarrantsthatitsemployeesandconsultantsmunEnglewoodParkway.Englewood.Colorado80110-2373(303)792-2300www.eng|ewoodgoM.crgrs.\m.:ISmlsgirUpulliunrf'|umlng§mi:u.:UEili'WTl'Page 198 of 319 shaiihavesufficientskill.knowledge.andtrainingtoperfom-IServicesandthattheServicesshallbeperfonnedinaccordancewiththestandardofcaredelineatedinSection3(8).(c)Personnel.Unlessaspeci?cnumberofemployeesissetforthintheStatementofWork.consultantwillprovidesuf?cientemployeestocompletetheServicesorderedwithintheapplicabletimeframesestablishedpursuanttothisAgreementorassetforthintheStatementofWork,DuringthecourseofperfomtanceofServices,Citymay,foranyornoreason,requestreplacementofanemployeeoraproposedemployee.insuchevent,Consultantshall.within?ve(5)workingdaysofreceiptofsuchrequestfromCity,provideasubstituteemployeeofsuf?cientskill,knowledge.andtrainingtoperfonntheapplicableServices.consultantshallrequireemployeesprovidingServicesataCitylocationtocomplywithapplicableCitysecurityandsafetyregulationsandpolicies.(d)compensationandBene?ts.Consultantshallprovideforandpaythecompensationofemployeesandshallpayalltaxes.contributions.andbene?ts(suchas,butnotlimitedto,workers’compensationbene?ts)whichanemployerisrequiredtopayrelatingtotheemploymentofemployees.CityshallnotbeliabletoConsultantortoanyemployeeforConsultant'sfailuretoperfonnitscompensation.benefit,ortaxobligations.Consultantshallindemnify,defendandholdCityharrniessfromandagainstallsuchtaxes,contributionsandbenefitsandwillcomplywithallassociatedgovernmentalregulations.includingthe?lingofallnecessaryreportsandreturns.14.indemni?cation.(a)consultantIndemni?cation.Consultantshallindemnify.defendandholdharmlessCity.itsdirectors,officers.employees,andagentsandtheheirs.executors,successors,andpermittedassignsofanyoftheforegoing(the‘citylndemnitees”)fromandagainstalllosses.claims,obligations.demands,assessments,?nesandpenalties(whethercivilorcriminal).liabilities.expensesandcosts(includingreasonablefeesanddisbursementsoflegalcounselandaccountants),bodilyandotherpersonalInjuries.damagetotangibleproperty,andomerdamages,ofanykindornature,sutferedorincurredbyaCityIndemniteetotheextentcausedby:(1)anynegligentactoromissionbyConsultantoritsrepresentativesIntheperformanceofConsultant'sobligationsunderthisAgreement,or(2)anymaterialbreachinarepresentation,warranty,covenantorobligationofConsultantcontainedinthisAgreement.Notwiu-islandingtheforegoing,intheeventthesubjectactionallegesnegligenceonthepartofConsultantand/orCity,oranythirdpartynotundercontractwithConsultant,Consultant'sobligationsregardingcity'sdefenseunderthisparagraphincludeonlythereimbursementoftheCity'sreasonabledefensecostsincurredtotheextendedConsultant'snegligenceasexpreslydeterminedbya?naljudgment.arbitration.award.order.settlement.orother?nalresolution.Consultantshallnotberesponsibleforbreachof?duciaryduty.lossofanticipatedpro?tsorforeconomic,incidentalorconsequentialdamagestoCityoranythirdpartyarisingoutofbreachofcontract,termination,orforanyotherreasonwhatsoever.Additionally,Consultantshallnotberesponsibleforactsanddecisionsofthirdparties.includinggovemmentaiagencies.otherthanConsuitant’ssubconsultants,thatimpactprojectcompletionand/orsuccess(b)infringement.Consultantwillindemnify,defend,andholdCityharmlessfromallIndemni?abieLossesarisingfromanythirdpartyclaimsthatanyWorkProductormethodologysuppliedbyConsultantinfringesormiseppropriatesanyintellectualPropertyrightsofanythirdparty;provided,however.thattheforegoingindemni?cationobligation1000ErlglewoodParkway,Erlglawoad.Colorado80110-2373(303)762-2300www.englewoodgov.orgl'SJtll‘l-ElMar,-su.m..av..n.....z....Satin:..ust\‘Wli'Page 199 of 319 shallnotapplytoanyallegedinfringementormisappropriationbasedon:(1)useoftheWorkProductIncombinationwithproductsorservicesnotprovidedbyConsultanttotheextentthatsuchinfringementormisappropriationwouldhavebeenavoidedIfsuchotherproductsorserviceshadnotbeenused:(2)anymodi?cationorenhancementtotheWorkProductmadebyCityoranyoneotherthanConsultantoritssub—consuitants;or(3)useoftheWorkProductotherthanaspermittedunderthisAgreement.(:2)indemni?cationProcedures.Notwith-standinganythingelsecontainedInthisAgreement.noobligationtoindemnifywhichissetforthinthisSection14shallapplyunlessthepartyclaimingindemni?cationnoti?estheotherpartyassoonaspracticabletoavoidanyprejudiceintheclaim.suitorproceedingofanymattersinrespectofwhichtheindemnitymayapplyandofwhichthenotifyingpartyhasknowledgeandgivestheotherpartytheopportunitytocontroltheresponsetheretoandthedefensethereof;provided,however.thatthepartyclaimingindemni?cationshallhavetherighttoparticipateinanylegalproceedingstocontestanddefendaclaimforindemni?cationinvolvingathirdpartyandtoberepresentedbyitsownattorneys.allatsuchparty’:costandexpense;providedfurther.however.thatnosettlementorcompromiseofanassertedthird-partyclaimotherthanthepaymentlmoneymaybemadewithoutthepriorwrittenconsentofthepartyclaimingindemni?cation.(d)Immunity.City,itsof?cers,anditsemployees,arerelyingon.anddonotwaiveorintendtowaivebyanyprovisionofthisAgreement,themonetarylimitationsoranyotherrights.immunities.andprotectionsprovidedbytheColoradoGovernmentalimmunityAct.C.R.S.24-10-101atseq.,asfromtimetotimeamended.orcthenwiseavailabletoCity.itsofficers.oritsemployees.15.Insurance.(a)Requirements.ConsultantagreestokeepinlullforceandeffectandmaintainatitssolecostandexpensethefollowingpoliciesofinsuranceduringthetermofthisAgreement:(1)TheConsultantshallcomplywiththeWorkers’CompensationActofColoradoandshallprovidecompensationinsurancetoprotecttheCityfromandagainstanyandallWorkers’Compensationclaimsarisingfromperformanceoftheworkunderthiscontract.Workers‘CompensationinsurancemustcoverobligationsimposedbyapplicablelawsforanyemployeeengagedIntheperfonnanceofmmunderthiscontract.aswellastheEmployers‘Liabilitywithintheminimumstatutorylimits.(2)CommercialGeneralLiabilityinsuranceandautoliabilityinsurance(includingcontractualliabilityinsurance)providingcoverageforbodilyInjuryandpropertydamagewithacombinedslngblimitofnotlessthanthreemilliondollars($3,000,000)peroccurrence.(3)Professionali.iabi|ity/EnorsandOmissionsinsurancecoveringacts.errorsandomissionsarisingoutofConsultant'soperationsorServicesinanamountnotlessthanonemilliondollars($1,000,000)peroccurrence.(4)EmployeeDishonestyandComputerFraudinsurancecoveringlossesarisingoutoforinconnectionwithanyfraudulentordishonestactscommittedbyConsultantpersonnel.actingaloneorwithothers.inanamountnotlessthanonemilliondollars($1,000,000)peroccurrence.(b)ApprovedCompanies.Allsuchinsuranceshallbeprocuredwithsuchinsurancecompaniesofgoodstanding.permittedtodobusinessinthecountry.stateorterritorywheretheServicesarebeingperformed.1000EnglawcodParkway.Engleuood.Colorado80110-2373(303)762-2300www.eng|ewoodgov.orgP51‘in-:5sum-ptfbuatuntr-mmsa.nu.11:mm-Page 200 of 319 lo)certi?cates.consultantshallprovideCitywithcerti?catesofinsuranceevidencingcompliancewiththisSection15(includingevidenceofrenewalofinsurance)signedbyauthorizedrepresentativesoftherespectivecarriersforeachyearthatthisAgreementisineffect.Certi?catesofinsurancewilllisttheCityofEnglewoodasanadditionalinsured,exceptastoWorkefsCompensationandProfessionalLiabilitylErrorsandOmissionsinsurance.Eachcerti?cateofinsuranceshallprovidethattheissuingcompanyshallnotcancelorreduce,theinsuranceaffordedundertheabovepoliciesunlessthirty(30)days’noticeofsuchcancellationorreductionhasbeenprovidedtoCity.16.RightsInWorkProduct.(a)Generally.acceptasspeci?callyagreedtothecontraryinanyStatementofWork.allintellectualPropertyRightsinandtotheWorkProductproducedorprovidedbyConsultantunderanyStatementofWorkshallremainthepropertyofConsultant.WithrespecttotheWorkProduct,ConsultantunconditionallyandirrevocablygrantstoCityduringthetermofsumIntellectualPropertyRights,anon-exclusive,irrevocable.perpetual,worldwide.fullypaidandroyalty-freelicense,toreproduce,createderivativeworksof,distribute.publiclyperformandpubliclydisplaybyallmeansnowknownorlaterdeveloped.suchintellectualPropertyRights.(biKnow-How.Notwithstandinganythingtothecontraryherein.eachpartyanditsrespectivepersonnelandconsultantsshallbefreetouseandemployitsandtheirgeneralskills.know-how.andexpertise.andtouse.disclose,andemployanygeneralizedideas,concepts.know-how.methods,techniques,orskillsgainedorteamedduringthecourseofanyassignment.solongasitortheyacquireandapplysuchinformationwithoutdisclosureofanyCon?dentialinformationoftheotherparty.17.RelationshipofParties.ConsultantisactingonlyasanIndependentconsultantanddoesnotundertake.bythisAgreement.anyStatementofWorkorotherwise,toperformanyobligationofCity.whetherregulatoryorcontractual,ortoassumeanyresponsibilityforCity’sbusinessoroperations.Neitherpartyshallactorrepresentitself.directlyorbyimplication.asanagentoftheother,exceptasexpresslyauthorizedinaStatementofWork.18.CompleteAgreement.ThisAgreementcontainstheentireagreementbetweenthepartiesheretowithrespecttothematterscoveredherein.19.ApplicableLaw.ConsultantshallcomplywithallapplicablelawsinperformingservicesbutshallbeheldharmlessforviolationofanygovernmentalprocurementregulationtowhichitmaybesubjectbuttowhichreferenceisnotmadeintheapplicableStatementofWork.ThisAgreementshallbeconstruedInaccordancewiththelawsoftheStateofColorado.AnyactionorproceedingbroughttointerpretorenforcetheprovisionsofthisAgreementshallbebroughtbeforethestateorfederalcourtsituatedinArapahoeCounty.Coloradoandeachpartyheretoconsentstojurisdictionandvenuebeforesuchcourts.2!).ScopeofAgreement.IfthescopeofanyprovisionsofthisAgreementistoobroadinanyrespectwhatsoevertopemtitenforcementtoitsfullestextent.thensuchprovisionshallbeenforcedtothemaximumextentpennlttedbylaw,andthepartiesheretoconsenttoandagreethatsuchscopemaybejudiciallymodi?edaccordinglyandthatthewholeofsuchprovisionofthisAgreementshallnottherebyfail,butthatthescopeofsuchprovisionshallbecurtailedonlytotheextentnecessarytoconfonntolaw.21.AdditionalWork.AfterreceiptofaStatementofWork.City.withConsultant'sconsent,mayrequestConsultanttoundertakeI000EnglewoodParkway.Englewood_coiorcoo80110-2373(303)762-2300www.englewoodgov.orgrs»./umSink-[itDpe1liiiIvIi’hii|ilriySn\i{ttnwuwrvPage 201 of 319 additionalworkwithrespecttosuchStatementofWork.Insuchevent.CityandConsultantshallexecuteanaddendumtotheStatementofWorkspecifyingsuchadditionalworkandthecompensationtobepaidtoConsultantforsuchadditionalwork.22.sub—consultants.ConsultantmaynotsubcontractanyoftheServicestobeprovidedhereunderwithoutthepriorwrittenconsentofCity.intheeventofanypennittedsubcontracting,theagreementwithsuchthirdpartyshallprovidethat.withrespecttothesubcontractedwork.suchsub—consu|tantshallbesubjecttoalloftheobligationsofConsultantspeci?edinthisAgreement.23.Notices.AnynoticeprovidedpursuanttothisAgreementshallbeinwritingtothepartiesattheaddressessetforthbelowandshallbedeemedgiven(1)ifbyhanddelivery.uponreceiptthereof,(2)three(3)daysafterdepositintheUnitedStatesmails.postageprepaid,certi?edmail,returnreceiptrequestedor(3)one(1)dayafterdepositwithanationally-recognizedovernightcourier,specifyingovernightprioritydelivery.EitherpartymaychangeitsaddressforpurposesofthisAgreementatanytimebygivingwrittennoticeofsuchchangetotheotherpartyhereto.24.Assignment.ThisAgreementmaynotbeassignedbyConsultantwithoutthepriorwrittenconsentofCity.Exceptfortheprohibitionofanassignmentcontainedintheprecedingsentence,thisAgreementshallbebindinguponandinuretothebene?toftheheirs.successorsandassignsofthepanieshereto.25.ThirdPartyBeneficiaries.ThisAgreementisenteredintosolelyforthebene?tofthepartiesheretoandshallnotconferanyrightsuponanypersonorentitynotapartytothisAgreement.NopersonorentitynotasignatorytothisAgreementshallbeentitledtorelyonConsultant'sperfonnanceofitsserviceshereunder,andnorighttoassertaclaimagainstConsultantbyassignmentofindemnityrightsorotherwiseshallaccruetoathirdpartyasaresultofthisAgreementortheperfomanceofConsultant'sserviceshereunder.26.Headings.ThesectionheadingsinthisAgreementaresolelyforconvenienceandshallnotbeconsideredinitsinterpretation.Therecitalssetforthonthe?rstpageofthisAgreementareIncorporatedintothebodyofthisAgreement.TheexhibitsreferredtothroughoutthisAgreementandanyStatementofWorkpreparedinconfomanoewiththisAgreementareincorporatedintothisAgreement.27.Waiver.ThefailureofeitherpartyatanytimetorequireperformancebytheotherpartyofanyprovisionofthisAgreementshallnoteffectinanywaythefullrighttorequiresuchperformanceatanysubsequenttime;norshallthewaiverbyeitherpartyofabreachofanyprovisionofthisAgreementbetakenorheldtobeawaiveroftheprovisionitself.28.ForceMajeure.ifperformancebyConsultantofanyserviceorobligationunderthisAgreementisprevented,restricted.delayedorinterferedwithbyreasonoflabordisputes.strikes.actsofGod,?oods,lightning.severeweather.shortagesofmaterials,rationing,utilityorcommunicationsfailures.earthquakes,war.revolution,civilcommotion,actsofpublicenemies,blockade.embargooranylaw,order.proclamation,regulation.ordinance.demandorrequirementhavinglegaleffectofanygcvemmeniaiorjudicialauthorityorrepresentativeofanysuchgovernment.oranyotheractwhethersimilarordissimilartothosereferredtoInthisclause.whicharebeyondthereasonablecontrolofConsultant,thenConsultantshallbeexcusedfromsuchperfonnancetotheextentofsuchprevention.restriction,delayorinterference.iftheperiodofsuchdelayexceedsthirty(30)days.Citymay.withoutliability,terminatethe1000EngiewoodParkway.Engiewood.Colorado60110-2373(303)762-2300www.eng|ewoodgov.orgrs.un.:sslumnmui.-.~man’...ScuismatuswwrrPage 202 of 319 affectedStatementofWor1<(s)uponwrittennoticetoConsultant.29.TimeofPerformance.1'rmeisexpresslymadeoftheessencewitl1respecttoeachandevery(emandprovisionofthisAgreement.30.Permits.Consultantshallatitsownexpensesecureanyandalllicenses,permitsorcertificatesthatmayberequiredbyanyfederal,stateorlocalstatute.ordinanceorregulationforthepertonnanoeoftheServicesundertheAgreement.ConsultantshallalsocomplywiththeprovisionsofallApplicableLawsinperformingtheServicesundertheAgreement.AtitsownexpenseandatnocosttoCity.Consultantshallmakeanychange,alterationormodi?cationthatmaybenecessarytocomplywithanyApplicableLawsthatConsultantfailedtocomplywithatthetimeofperformanceoftheServices.31.MediaReleases.ExceptforanyannouncementintendedsolelyforinternaldistributionbyConsultantoranydisclosurerequiredbylegal,accounting,orregulatoryrequirementsbeyondthereasonablecontrolofConsultant,allmediareleases,publicannouncements.orpublicdisclosures(including,butnotlimitedto,promotionalormarketingmaterial)byConsultantoritsemployeesoragentsrelatingtothisAgreementoritssubjectmatter,orincludingthename,trademark,orsymbolofCity,shallbecoordinatedwithandapprovedinwritingbyCitypriortothereleasethereof.ConsultantshallnotrepresentdirectlyorindirectlythatanyServicesprovidedbyConsultanttoCityhasbeenapprovedorendorsedbyCityorincludethename,trademark,orsymbolofcityonalistofConsultant'scustomerswithoutCity'sexpresswrittenconsent.32.NonexclusiveMarketandPurchaseRighu.itisexpresslyunderstoodandagreedthatthisAgreementdoesnotgranttoConsultantanexclusiverighttoprovidetoCityanyoralloftheServicesandshallnotpreventCityfromacquiringfron1othersuppliersservicessimilartotheServices.ConsultantagreesthatacquisitionsbyCitypursuanttothisAgreementshallneitherrestricttherightofCitytoceaseacquiringnorrequireCitytocontinueanylevelofsuchacquisitions.EstimatesorforecastsfurnishedbycitytoConsultantpriortoorduringthetermofthisAgreementshallnotconstitutecommitments.33.Survival.TheprovisionsofSections5,8(9),10,11,13,14,16,17,19,23,25and31shallsurviveanyexpirationortemrinalionforanyreasonofthisAgreement.34.Veri?cationofCompliancewithC.R.$.8-17.5-101ET.sEQ.RegardingHiringofIllegalAliens:(a)Employees,ConsultantsandSub—consultants:ConsultantshallnotknowinglyemployorcontractwithanillegalalientoperfonnworkunderthisContract.Consultantshallnotcontractwithasub-consultantthatfailstocertifytotheConsultantthatthesub—consultantwillnotknowinglyemployorcontractwithanillegalalientoperformworkunderthisContract.[CR88-17.5-102(2)(a)(|)&(II).](b)Verification:ConsultantwillparticipateineithertheE-VerifyprogramortheDepartmentprogram,asde?nedinC.R.S.B-17.5~1D1(3.3)andB-17.5-101(3.7).respectively,inordertocon?rmtheemploymenteligibilityofallemployeeswhoarenewlyhiredforemploymenttoperformworkunderthispubliccontractforservices.ConsultantisprohibitedfromusingtheE-VerifyprogramortheDepartmentprogramprocedurestoundertakepre-employmentscreeningofjobapplicantswhilethiscontractisbeingperformed.(c)DutytoTerminateaSubcontract:ifConsultantobtainsactualknowledgethatasub-consultantperforming1000EnglewoodParkway.Englewood,Colorado80110-2373(303)762-2300www.englewoodgrw.orgr‘§AIt1-:5MialqkOp:!Ili1lIlI|.\nIl|lI?S:-«lanai|JE\\'W‘n'Page 203 of 319 workunderthisContractknowinglyemploysorcontractswithanillegalalien.theConsultantshall;(1)notifythesub-consultantandtheCitywithinthreedaysthattheConsultanthasactualknowledgethatthesub-consultantisemployingorcontractingwithanillegalalien;and(2)terminatethesubcontractwiththesub-consultantif.withinthreedaysofreceivingnoticerequiredpursuanttothisparagraphthesub-consultantdoesnotstopemployingorcontractingwiththeIllegalalien;exceptthattheConsultantshallnotterminatethecontractwiththesub-consultantifduringsuchthreedaysthesub-consultantprovidesinformationtoestablishthatthesub—consu|tanthasnotknowinglyemployedorcontractedwithanIllegalalien.(cl)DutytocomplywithStateinvestigation:ConsultantshallcomplywithanyreasonablerequestoftheColoradoDepartmentofLaborandEmploymentmadeinthecourseofaninvestigationbythattheDepartmentisundertakingpursuanttoC.R.S.8475-102(5)(e)DamagesforBreachotcontract:TheCitymayterminatethiscontractforabreachofcontract.inwholeorInpart.duetoConsultant'sbreachofanysectionofthisparagraphorprovisionsrequiredpursuanttoCR58-17.5-102;Consultantshallbeliableforactualandconsequentialdamagestothe'CityinadditiontoanyotherlegalorequitableremedytheCitymaybeentitledtoforabreachofthisContractunderthisParagraph34,(flEstimatesandProjections:inprovidingoptionsofcost.?nancialanalyses,economicfeasibilityprojections.andschedulesforpotentialprojects.Consultanthasnocontrolovercostorpriceoflaborandmaterial;unknownorlatentconditionsofexistingequipmentorstructuresthatmyaffectoperationandmaintenancecosts;competitivebiddingproceduresandmarketconditions;timeorqualityofperformanceofthirdparties;quality.type,management,ordirectionofoperatingmanagement.ordirectionofoperatingpersonnel;andothereconomicandoperationalfactorsthatmaymateriallyaffecttheultimateprojectorschedule.Therefore,ConsultantmakesnowarrantythattheCity'sactualprojectcosts.?nancialaspects.economicfeasibility.orscheduleswillnotvaryfromConsultants‘opinions.analyses,projections.orestimates.1DDDEngiewoodParkway.Englewuod.Colorado30110-2373(303)762-2300www.enqIewoodgov.org(‘SA/I7-2!KirllqitDykuiiumrumagmituuu:wwrriiPage 204 of 319 INWITNESSWHEREOF,thepartiestothisAgreementhavecausedittobeexecutedbytheirauthorizedofficersasoftheclayandyeartirstabovewritten.ThisAgreementmaybeexecutedincounterparts,eachofwhichshallbedeemedanoriginal,butallofwhichtogethershallconstituteoneandthesameinstrument.CITYOFENGLEWOOD,COLORADOBy:Date:lbapanmonxDirector)By:Date:(Citymananar)By:Date:(Maynr)ATFEST:CityClerk0i(ConsultantMama)3“)oI??dgta9Cfescn-at3-k_800Address1[d(,9$2007,Icny,Slate,zipcodeI000EngtewundParkway‘Englewowd,Colorado80110-2373(303)762-2300www.eng|ewoadguv.o1gPSA/I1-2‘Su:Irw'=nnummm.....a..,,Senisev.tu:wwn-Page 205 of 319 SCHEDULEAOUTLINEOFSTATEMENTOFWORK1.GENERALThisScheduleisattachedtoandmadeapartoftheProfessionalServicesAgreementdatedgeezerI’).2017.betweentheCityofEngiewood(CITY)andcarolloEngineers.inc(CONSULTANT)forprofessionalservicesfortheStrategicOperationsPlanProject.24NAMESOFPROJECTCOORDINATORSTheCity'sProjectManagerwillbeChongWoo.RE.TheConsultant'sProjectManagerwillbeBeckyLuna,PE.3.SUMMARYOFPURPOSEFORSTATEMENTOFWORKTheConsultantwillprovideplanningservicestodevelopastrategicoperationsplan(SOP)toaddressoperationalneeds.meetpendingregulatoryrequirements.andprovideoostoptimizationopportunitiesattheLittielonEngiowocdWastewaterTreatmentPlant(UEWWTP).4.EQUIPMENTANDPROGRAMMINGTOBEPROVIDEDBYCITY(IFANY)TheCITYwillprovidedataandinformationrequestedbytheCONSULTANT,ifavailable.5.OTHERCONSULTANTRESOURCESTheCONSULTANTwillprovidethemanagementandtechnicalexpertisetocompletethescopeofworkdescribedbelow.Theseindividualsconsistofthefollowingbutarenotlimitedto;projectmanagement,technicalexpertsInwastswatertreatmentoperations,planning,andengineering.6.DESCRIPTIONOFWORKPRODUCTANDDELIVERABLESTheCONSULTANT‘:scopeofworkincludesthefollowingtasksanddeiiverabies.Task1-ProjectManagementSubtask1.1—ProjectManagementandAdministrationCONSULTANTshallprovideprojectmanagementservices.whichincludetheloliowlngtasks:-ProjectinitiationoPrepareProjectManagementPlanforprojectteamsummarizingprojectscope,projectresponsibilitiesandoontacts,projectresourcesandcommunicationplan.projectstaf?ngplan.andprojectbudget.1000EnglewoodParkway,Englawood.Colorado30110-2373(303)762-2300www.eng|cwoodgov.ornmumst...-.sn......:.....i-t.y.»r.t,s«ae.:|IJE\lIVIl1iPage 206 of 319 oCoordinateinternalprojectkickoffmeeting.-Preparemonthlyprogressreports,-Maintainandmonitorprojectscope,budget,andschedule.-Provideadministrativeguidanceandsupervisionofstaff,includingprojectplanning.CONSULTANTwillsetupandmaintainashareFointsitefor?lesharingforthedurationoftheproject.subtask1.2-Workshop1:KickoffMeetingTheCONSULTANTwillcoordinateandattendaprojectkickoffmeetingtoreviewthescopeofworkanddevelopandde?netheC|TY'sgoalsandobjectivesfortheprojectDuringthekickoffmeeting,theteamwillbegintoIdentifythebusinesscaseevaluation(BCE)criteriathatwillbeusedthroughouttheproject.ThekickoffmeetingwillalsobeusedtoreviewtheexistinglnforEAMmaintenancemanagementsystemtoIdentifymissinginformationasitrelatestoassetconditions.Thekickoffmeetingwillalsoincludeadiscussionoftheappropriateprocessmodelsoftwaretobeusedfortheproject.Inaddition,theCONSULTANTwillidentifyadditionalspecialsamplingandpotentialdemonstrationteststobeconductedduringtheprojectsubtask1.3-QualitycontrolandAssuranceCONSULTANTshallprovideanongoingin-housequalitycheckoftheworkbeingperformedaspartoftheproject.Anindependentteamwillprovideareviewoftheprocessmodel,drafttechnicalmemoranda,costestimates.capitalimprovementsprogram(CIP)model,andSOPreportinparallelwiththeClTY‘sreview.AppropriatecheckcommentswillbeincorporatedIntothe?nalreport.Task2-Phase1:SettingDirectionsubtask2.1—ExistingDocumentandFacilitiesReviewTheCONSULTANTwillreviewinformationanddatafortheexistingfacilitiesandoperatingconditions.Thisanalysiswillincludeageneralreviewofhistoricalplantdata,pertinentfacilitydesigncriteria,drawingsandreports,powerconsumptionandenergybills,andpertinentregulations.Thistaskalsoincludesareviewofpopulationprojections(perlomiedbyothers)fortheUEWWTPservicearea.subtask2.2-DevelopPlanningBoundariesandBCECriteriainconjunctionwiththeProjectKickoffMeeting,CONSULTANTwillfacilitateanInteractivediscussiontoestablishSOPobjectivesanddevelopboundaryconditionsandBCEcriteria.CITYwillprovideinputandassistanceondevelopmentofplanningboundaryconditionsandregulatorycriteria.BCEcriteriawillsubsequentlybeusedtoevaluateandrankthetreatmentalternativesidenti?edinTask3.CONSULTANTandtheCITYwillidentifypreliminaryperformancemeasurestobeusedtoquantifyorqualitativelyassessthedegreetowhicheachalternativesatis?eseachcriterion.ThediscussionMilalsoincludeidenti?cationofaprocessforassessingandquantifyingtherelativeimportanceofeachcriterion.FindingsfromthissubtaskwillbesummarizedinTM1—PlanningBoundaryConditionsandBCECriteria.TheCITYwillprovidewrittencommentsonthedraftTMwithinfourteen(14)calendardays.1000EnglewoodParkway,Englewocd.Colorado8011D<2373(EDS)792-2300www.engiewoodgov.orgrsixmaxSuair?tOgeialulrorims.Smite»..ul:ww-n-Page 207 of 319 CONSULTANTwillreviewtheC|TY'scommentsfromthedraftTMandwillincorporatethemintoa?nalSOPreport,asappropriate.Subtask2.3-FlowandLoadProjectionsCONSULTANTwillupdate?owandloadprojectionsfortheL/EWWTPserviceareathroughtheyear2040.CONSULTANTwilldevelopupdatedunit?owandloadingratespercapita(gallonsBOD,TKN.andTP)basedonareviewofhistoricalin?uentiiowandloaddatafrom2010topresent.CONSULTANTwilluseupdatedpopulationprojections(providedbytheCITY)andupdatedunitflowandloadingratespercapitatodeten'nineprojectedin?uentflowandloadingconditionsto2040.Subtask2.4-AssessmentofAssetManagementInformationTheCONSULTANTwillattendameetingwiththeCITYtoreviewtheexistinglniorEAMsystem.InconjunctionwiththeCITY,theCONSULTANTwillidentifyselectedfacilityassetswhoseconditionsarenotwellde?nedwithinthelnforEAMsystem.ThistaskwillincludereviewingtheresultsoftheWorkforceAlignmentandstrategyAdvisement(WASA)analysistocon?rmconsistencyinapproach.CONSULTANTwillusetheconditionassessmentprocessandproceduresdevelopedanddocumentedaspartofthe2013FadlltyPlan.Subtask2.5-ConditionAssessmentCONSULTANTwillconductavisualconditionassessmentofthemechanical,structural,electrical,instrumentation,andoperationandmaintenanceconditionofselectedprocessareas(asde?nedinSubtask2.4)withintheLIEW\IVTF.CONSULTANTbudgetedtospendoneB-hourdayon-sitewithuptosixteammembers.inadditiontovisualinspection.theassessmentwillincludediscussionswithoperationsstaffrelatedtopotentialoperationalissuesexperiencedwiththeequipment.Findingsfromtheconditionassessment,includingrecommendedupgrades(i.e.,equipmentreplacement.modi?cationsforcodecompliance).willbesummarizedinTM2—AssetManagementFindings.Asummaryoipriorityprojectswillbedevelopedthatincludestheplanning-levelestimatedcostofrehabilitationorreplacementCostestimateswillbedevelopedlotheClass4levelperthestandardsoftheAssociationfortheAdvancementofCostEngineering(AACE).TM2willalsoincludeandintegrate?ndingsfromtheWASAprojectandanyrecommendationsforproceduralmodi?cationstotheexistingassetmanagementprogram.TheCITYwillprovidewrittencommentsonthedraftTMwithinfourteen(14)calendardays.CONSULTANTwillreviewtheClTY'scommentsfromthedraftTMandwillIncorporatethemintoa?nalSOPreportasappropriate.Subtask2.6-Workshop2:ReviewPhase1FindingsCONSULTANTshallprepareforandattendWorkshop2toreviewthe?ndingsfromSublasks2.1through2.5.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.1000EnglewoodParkway.Englewood,Colorado80110-2373(303)762-2300www.englewoodguv.orgut.\n-i.:<«mow;Djmaliinul'l.\iin'ingSrii'it:1uurwwrrPage 208 of 319 Task3-Phase2:CreateRoadMapSublask3.1-DevelopcalibratedProcessModelCONSULTANTshalldevelopandcalibrateaBiowinand/orGPS-XprocessmodelfortheLIEWVVTPbasedoncurrent?owsandloadingsderivedlromthelastthreeyearsofavailableprocessdata.TheperiodstobeusedforcalibrationfromtheexistingdatawillbecoordinatedwiththeCITY.Calibrationwillbedevelopedtoareasonableprecisionsuitableforplanning-levelanalyses.basedonCONSULTANT'sexperience.TheCITYwillsupportthistaskthroughspeci?cplantin?uentandprocesspro?lesamplingasneededandascapabilitiesallow.CONSULTANTshallsubmitthecalibratedprocessmodeltotheCITYandprovideuptothree(3)4-hourworkshopsfortrainingontheuseoftheprocessmodelforday-to-dayplantoperation.subtask3.2—ExistingCapacityAnalysisConsultantshallreviewthepreviousthreeyearsofprocesspertonnanceattheUEiNWTP,usingtheRegulation85andanticipatedRegulation31permitrequirements.Site-speci?cdesigncriteriaandsafetyfactorswillbeusedbasedonactualprocessperformancetoidentifythecapacityofeachunitprocess.Withinthissubtask.theCONSULTANTwillworkwiththeCITYandtheColoradoDepartmentofPublicHealthandEnvironment(CDPHE)to:-Evaluateinstalledcapacitiesloreachprocessandevaluatetheredundancyrequirementstomeetbothpennittedcapacityandcurrentflowandload.-ReviewsequencedstagingandexpansionplanswithCDPHEbasedonmaintainingthepennittedcapacityforfutureregulations,and-Evaluatethequalitativeand?nancialimpactsformaintainingtheperrnlttedcapacityrating.ChemicalusageswillbereviewedandasystemwidealkalinitybalanceandorganiccarbonbalancewillbeestablishedtoIdentifypossibleoptimizationopportunitiesforreducingchemicalandlorenergyuse.FindingsfromSubtasks3.1and3.2willbesummarizedinTM3—ExistingCapacityAnalysis.TheCITYwillprovidewrittencommentsonthedraftTMwithinfourteen(14)calendardays.CONSULTANTwillreviewtheCITY'scommentsfromthedraftTMandwillincorporatethemintoa?nalSOPreportasappropriate.Subtask3.3—IdentifyandEvaluateTreannentAlternativesTheCONSULTANTshallIdentifyandevaluateuptofour(4)alternativestomeetRegulation65permitlimits.inadditiontoanalternativeanalysis.alistofprojectsthatareindependentofandconsistentwiththeRegulation85improvementswillbedevelopedtoimprovereliability,redundancy,andprocesscontrolattheLIEWWTP.Forthealternativeanalysis,CONSULTANTwilldevelopschematiclayoutsandplanninglevelcostestimates.followingCONSULTANT'sstandardcostestimateapproachandbasedontheAACE‘scost1000EnglewoodParkway.Englewood.Colorado80110-2373(303)762-2300www.englewoodgav.orgmm:5llnrgkopa.n....m...m§rl\7(tlIlonww‘rvPage 209 of 319 estimateclassi?cationmatrix,foreachalternative.20-yearlifecyclecostswillbeprovidedasapplicable.EachaitemativewillbeevaluatedusingtheproposedcriteriaandperformancemeasuresasdocumentedinTM1-PlanningBoundaryConditionsandBCECriteria.Thealtematlvesthatbestmeetthemostimportantobjectiveswillbeprioritizedforpotentialimplementation.inordertoconlinnmodelpredictionsandidentifyunintendedconsequences,theCONSULTANTwillassisttheCITYwithdevelopmentoftestplanstotestuptotwo(2)processmodi?cations.itisassumedthattheCITYwillleadandconducttheexecutionofthetestingplansandwillcollectandprocesssamplesasde?ned.DataanalysisandsupportingprocessmodelingwillbeconductedbyCONSULTANT.TheCITYwillsendallrelevantrawtestdata,datasummaries.andgraphsinExcelformattotheCONSULTANTonaweeklybasiswhilefull-scaletestingisongoinganda?ercompletion.CONSULTANTwillreviewthetestingresultsandconsultwithCITYonInterpretationoftestdata,adjustmentsandoptimizationoftestingstrategies,andadjustmentofsamplingplansthroughweekly30-minuteconferencecalls.CONSULTANTshallprepareforandattendWorkshop3toreviewtheprocessmodel.capacityanalysis,andtoidentify,inconjunctionwithCITYstall,thepreferrednutrientremovalaitemativestomeetRegulation85dischargerequirements,CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.subtesk3.4—IdentifyResourceRecoveryOpportunitiesCONSULTANTwillevaluateuptothree(3)resourcerecoveryopportunitiesforincorporationintotheL/EWWTP.CONSULTANTwillperformaninitialfeasibilityevaluationandworkwithequipmentmanufacturerstoobtainrelevantdesigncriteriaandunitsizing.CONSULTANTwilldevelopschematiclayoutsandplanninglevelcostestimates.followingCONSULTANT‘sstandardcostestimateapproachandbasedontheAACE'scostestimateclassificationmatrix,foreachaltematlve.20-yearlifecyclecostswillbeprovidedasapplicable.Thissubtaskwillalsoincludeaplant-wideenergyconsumptionanalysisandde?nitionofstatus-quoenergyinputbenchmarks.Aplant-wideenergyconsumptioninventorywillbedeveloped,documentingaverageandpeakenergyrequirementsforeachpieceofequipment.TheUEVViNTPwillbecomparedtosimilarfacilitiesacrossthecountrybaseduponthefollowingcriteria:-kWhpermilliongallonperday(mgd)treated,-kWhperpoundperday(ppd)ammoniaremoved,-kWhorgreenhousegasemissionperppdnitrateandphosphorusremoved.CONSULTANTwillquantifytheenergysavingsthatmayberealizedbyeliminatingtheprimarytrickling?lters.CONSULTANTwillcomparethecostofpumpingnitri?edeffluentrecycleagainstthebenefitofodorcontrolandreducedmethanoladdition.subtask3.5-AddressOperationalChallengesCONSULTANTwillreviewexistingoperationalchallengeswiththeCITYanddeveloppossiblesolutionsforincorporationintothetreatmentaltemativesidenti?edinSubtask3.3.Theoperationalchallengesthatwillbeevaluatedinclude:1000EnglawoodParkway.Englewood.Colorado80110-2373(303)762-2800www.engiewoodgov.orgmums...-ole-amt...n....x....s..r......ummPage 210 of 319 .Struvltebuildupinpipesandequipment.-Depositionofsnailsdownstreamofeachsetoftrickling?lters,and-Capacitylimitationsinthesolidstreatmentprocess.CONSULTANTwilldrawuponoperationalexperienceatotherfacilitiestodevelopsolutionstotheexistingoperationalchallenges.Aspartoithissubtask,CONSULTANTshallevaluatepotentialoperationalcostsavingsandstaf?nglevelsforproposedCIPprojeas.Findingsfromsubtasks3.3through3.5willbesummarizedinTM4-AlternativeAnalysisandSelection.TheCITYwillprovidewrittencommentsonthedraftTMwithinfourteen(14)calendardays.CONSULTANTwillreviewtheCiTY'scommentsfromthedraftTMandwillincorporatethemintoa?nalSOPreportasappropriate.Suhtask3.6-Workshop4:ReviewPhase2FindingsCONSULTANTshallprepareforandattendWorkshop4toreviewthe?ndingsfromPhase2.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.Task4—Phase3:BegintheJourneySuhtask4.1-DevelopCIPRoadmapsConsultantwillgrouptherecommendedimprovementsfromPhase2intotwo(2)distinctCIPplans.Consultantwillprioritizeprojectsusingspeci?ctriggers(i.e.permitrenewal,capacity,operationalreliabilityandredundancy,assetrenewal)todeveloptheC|Ps.Planninglevelcostestimateswillbesummarizedbyproject.Subtask4.2—CompleteSWOTAnalysisCONSULTANTshallconductahait—dayworkshop(Workshop5)toanalyzethestrengths,weaknesses,opportunities,andthreats(SWOTanalysis)ofthetwoproposedpathsforward.Theanalysiswillconsidertriplebottomlineevaluations,operatingcosts,staf?ngprojections,projectdelivery(including?nancingoptions),governanceconsiderations(|.e.budgeting,infonnationtechnology,etc),andadaptabilitytoaddressMoreregulations.subtask4.3—Re?neCIPRoadmapandSelectPreferredAlternativeBasedontheresultsoftheSWOTanalysis,CONSULTANTshallre?netheselectedCIP.CONSULTANTshallprepareforandattendWorkshop6toreviewthere?nedCIProadmap.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.FindingsfromSublasks4.1through4.3willbesummarizedinTM5—-CIPRoadmap.ThecrrvwillprovidewrittencommentsonthedraftTMwithinfourteen(14)calendardays.CONSULTANTwillreviewtheClTY'scommentsfromthedraftTMandwillincorporatethemintoafinalSOPreportasappropriate1000EnglswoodParkway.Englswood,Colorado80110-2373(303)762-2300www.eng|ewoodgov.ornrsnII1-saw-rut:opnutuaflamingSm-iruuupmmPage 211 of 319 Suhtask4.4-IntegrationoflnforEAMdataIntotheCIPCONSULTANTshallconductagapanalysistoevaluateCityofEnglewoodrequirements,LlEWWTP'apriority-basedbudgetingapproach,thelnforEAMso?ware.andindustrybestpracticestodetenninethemostefficientandeasiestapproachtoIntegrateandmaintainCIPinformation.CONSULTANTshallprepareforandattendWorkshop7todiscussintegrationottheCIPIntolnforEAM.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.CONSULTANTwillprovideaMicrosoftExcel-basedsoftwaretoolwhichincludesoutputsfromthelnforEAMdatabaseandothercapitalimprovementprojectsasIdenti?edintheSOP.Subtask4.5-DraftandFinalReportCONSULTANTshallprepareadraftSOPReporttocompiletheTMsdevelopedaspanofTasks1through4,includinganexecutivesummary.ThereportcontentwillbepresentedtotheCITYatWorkshop8.TheCITYwillreviewthedraltSOPReportandprovidecommentswithin15workingdays.CONSULTANTwillreviewtheClTY'scommentsfromthedraftSOPReportandwillincorporatethemintothe?nalSOPReportasappropriate.Subtask4.6-CityCouncilPresentationCONSULTANTshallprepareforandattendaCityCouncilmeetingtopresenttheresultsoftheStrategicOperationsPlanProject.Dellverablesforthisprojectincludethefollowing:-ProjectManagementPlan.-MonthlyProgressReportsandInvoices;PDF?lesprovidedbyemailtothecITY’sProjectManager.-Meetingagendas,meetingsummaries;PDF?lesbye-mall.-DraftTMs;PDF?lesprovidedbye-mail.oTM1-PlanningBoundaryConditionsandBCECriteria.oTM2-AssetManagementFindings,0TM3-CapacityAnalysis.oTM4-AlternativeAnalysisandSelection.oTM5-CIPRoadmap.Testingplans;PDF?lesprovidedbye-mail.BiowinProcessModelinnativeformatMicrosoftExcel-basedCIPsoftwaretoolDraftand?nalSOPReport;?ve(5)copieswillbeprovidedalongwithPDF?lesprovidedbye-mail.7.SPECIALTERMS,IFANYNoneidenti?ed.IODUEngiewnodParkway.Englswood.Colorado501104373(303)752-2300www.englewoodgov.orgI'$.\lt‘I.:lman-sieom-nhuim-.iu.smcanulvwnrPage 212 of 319 8.MODEOFPAYMENTTheCITYandCONSULTANThaveestablishedanot—to—exceedbudgetof$500,000forthescopeofservicesdescribedinthisletter.CONSULTANTshallsubmittheFinalReportwithineight(8)monthsfromwrittenNoticetoProceed.9.PAYMENTSCHEDULECITYwillpayCONSULTANTfortheworkonamonthlybasisbasedontheprojectpercentcomplete,ascalculatedbytheCONSULTANT.CONSULTANTshallprovidemonthlyprogressreportsdetailingworkcompletedinthatmonthforapprovalbyCITY.10.SCHEDULEANDPERFORMANCEMILESTONESThisschedulesetsforthetargetdatesandperformancemilestonesforthepreparationanddeliveryoftheDeliverablesbyCONSULTANT.PerformanceMilestoneResponsibleTargetDateParty(Calendardays)NoticetoProceedCITYTBD(Day0)Workshop1:Kick-OffMeetingCITYIDay14CONSULTANTConditionAssessmentCONSULTANTDay24TM1-PlanningBoundaryConditionsandBCECONSULTANTDay40CriteriaWorkshop2:Phase1FindingsCITYIDay50CONSULTANTTM2-AssetManagementFindingsCONSULTANTDay60Workshop3:ProcessModelandCapacityCITYIDay65AnalysisCONSULTANTTM3-CapacityAnalysisCITYDay751000EnglewundParkway.Englewood.Colorado50110-2373(303)762-2300www.englewoodgov.orgP§'AIl1~).lsum.-y'=Opuiinmn....a..smut.uevwmPage 213 of 319 Workshop4:Phase2FindingsCITYIDay115CONSULTANTTM4-AlternativeAnalysisandSelectionCONSULTANTDay125Workshop5:SWOTAnalysisCITYIDay150CONSULTANTWorkshop6:Re?neCIPRoadmapC|TY/Day165CONSULTANTTM5-CIPRoadmapCONSULTANTDay180Workshop7:CIPIntegrationCITYIDay190CONSULTANTDraftSOPReportCONSULTANTDay200FinalSOPReportCONSULTANTDay22511.ACCEPTANCEANDTESTINGPROCEDURESNotapplicable.12.LOCATIONOFWORKFACILITIESSubstantiallyalloftheworkwlllbeconductedbyCONSULTANTatItsregularoflicelocatedinBroom?ald.Colorado.munEnglswoodParkway.Englswood.Culuradu50110-2373(303)152-2300www.aIIglcwundgw.urgI'§I\/I7~1‘MrIl([lE?pcuuumI-:....a.,,s..amnuucwwnvPage 214 of 319 INWITNESSWHEREOF.pursuantandinaccordancewiththeProfessionalServicesAgreementbetweenthepartiesheretodatedofWorkasofthisdayofCITYOFENGLEWOOD,COLORADOBy:(S\gn:luve)(FnnlNlme)Tille:Date:CAROLLOENGINEERSINCCONSULTANTNameB(sgnamre)uI:N6(PrintName)me;LA:5?smewxfDare;4.§'l'V,2017,thepartieshaveexecutedthisStatement,2017,1UDDEnglewoudParkway.Eng\ewoud.Colorado80110-2373(303)762-2300www.eng¥ewoudgav.orgmm.:san...“Upenlmm1-:.....x..,Su?tclal:15wwwPage 215 of 319 October 16, 2017Littleton/Englewood WWTPStrategic Operations PlanPage 216 of 319 Strategic Operations Plan• Identified in 2017 Budgeto“Regulation 85 (Nutrients) Project”oPhosphorus and Nitrogen permit requirements• Planning needed beyond just Regulation 85oChallenges and new opportunitiesoHolistic approachPage 217 of 319 Road MapLeverage Existing InfrastructureNet Positive Environmental BenefitPosition for Future RegulationsPreserve Community AssetSustained Operational ExcellencePage 218 of 319 Fiscal ResponsibilityDefensible and Holistic 5-year Plan• Phosphorus and Nitrogen• Chemical versus Biological Treatment• Long Term Impacts Page 219 of 319 Risk ManagementDefensible and Holistic 5-year Plan• Preliminary Treatment Process• Solids Processing• Electrical Systems• Underground Infrastructure Page 220 of 319 Effective OperationsDefensible and Holistic 5-year Plan• Struvite Maintenance• Microorganism Accumulation• Preliminary Treatment• Solids Processing Page 221 of 319 Cost OptimizationDefensible and Holistic 5-year Plan• Chemical Processes• Pumping Systems• Solids Processing Page 222 of 319 Resource RecoveryDefensible and Holistic 5-year Plan• Phosphorus Recovery• Sidestream Treatment• Solids Processing Page 223 of 319 Consultant Selection•Request for Proposal (RFP) process•7 proposals received:• Brown and Caldwell• Carollo Engineers• CDM Smith• CH2M• Dewberry• HDR• Stantec/MWH•Selection process and interviewsPage 224 of 319 • SOP Engineering Services:oCarollo Engineers, Inc.o$500,000Contract RecommendationPage 225 of 319 Budget• L/E WWTP CIP Budget:Budget Expensed (8‐23‐17)$2,000,000 $730,132 Page 226 of 319 Schedule• 2018 – Complete SOPoIdentify project definitions, schedules and budget forecastsoIdentify fundingoTechnology evaluation and Pilot studies• 2019 – Design and Project BiddingoSite applicationoEngineer selection• 2020/2022 – ConstructionoContract awardoCommissioning Page 227 of 319 Questions?Page 228 of 319 /2//4?”LITTLETON/ENGLEWOODWASTEWATERTREATMENTPLANTCityofCityof§:‘;f,f;.,'Z:f‘3.§‘.;',:'.,'§';“;.,oLlttletonEnglewood(ans)762-2500FAX7s2—2a2nMINUTESSUPERVISORYCOMMITTEEMEETINGMay18,201710:00am.ATTENDING:EricKeckEnglewoodCityManagerMarkRelphLittletonCityManager(viaConferenceCall)BrentThompsonCityofLittleton,EngineerDaveHendersonEnglewoodPublicWorksDirectorDavidRobbinsHill&RobbinsMattMontgomeryHill&RobbinsDennisW.StoweL/EWWTPDirectorChongWooL/EWWTPEngineering/MaintenanceDivisionManagerCindyGoodburnL/EWWTPBusinessServicesDivisionManagerDanDeLaughterL/EWWTPEnvironmentalComplianceDivisionManagerJimTallentL/EWWTPTreatmentDivisionManagerShahidMalikL/EWWTPEnvironmentalServicesDivisionManagerTimGrossbachL/EWWTPPretreatmentSpecialistIIBrendaVarnerL/EWWTPExecutiveAssistantGUESTS:CynthiaLanePlatteCanyonWater&SanitationDistrict,AssistantManagerGunterRitterL/EWWTPProjectEngineerSarahReevesBrownandCaldwell1,WELCOME,APPROVALOFPRIORMEETINGMINUTES,ANDFLOWSANDLOADINGSDennisW.Stowe,Littleton/EnglewoodWastewaterTreatmentPlant(L/EWWTP)Director,openedtheMaymeetingwithreviewandapprovaloftheApril20,2017SupervisoryCommittee(Committee)meetingminutes.ACTIONTAKEN—TheSupervisoryCommitteeapprovedtheminules?omtheApril20,2017SupervisoryCommitteemeeting.DaveHendersunmoved,EricKeckrewnded,allinfavar.Therecordingsecretary,BrendaVamer,notedthatthemeetingminutesfortheMay18,2017meetingwillneedelectronicapprovalsothattheycanbeattachedtoCouncilCommunicationsfortheJune19,2017EnglewoodCouncilmeeting.BrendawillsubmitmeetingminutesforapprovaltoCommitteemembersviaemail.Thisprocesswillbeuseduntilproceduresthataremoreefficientareidentified.DennisStowesummarizedthe?owsandloadingstotheLIEWWTP.TheL/EWWTPaveragedatotal?owof21.0milliongallonsperday(mgd)duringthemonthofApril2017.Themonthly?owaverageincreasedby0.9Page 229 of 319 MINUTESSUPERVISORYCOMMITTEEMEETINGMay18,2017Page2of7mgdfromMarch2017.Thesplitoftheaveragemonthly?owsforthecitiesofLittletonandEnglewoodrespectivelywere42.1%and579%.ll.ACTIONITEMSforPresentationPopulationStudy—ChongWooChongWooreviewedtheMarch9,2017JointCouncilMeeting.Atthemeeting,theCouncilsdirectedL/EWWTPtoupdatethepopulationstudyand?owdatafortheLIEWWTPservicearea.L/EWWTPsolicitedarequestforservices?omtwoconsultantsknownintheindustrytoperformpopulationdataandforecastprojections,ClarionAssociatesandEconomicandPlanningSystems,Inc.(EPS).Clariondeclinedtosubmitaresponse,statingthatEPSwouldbebetterequippedandquali?edtoprovideservices.L/EWWTPstaffhavereviewedEPS’sresponse,andhavedeterminedthattheproposalmeetsL/EWWTP’:goalsandobjectives.Thepreviouspopulationstudywascompletedaspartofthe2013L/EWWTPMasterPlan.Inthisanalysis,datawascollectedfromDRCOG'sTrafficAnalysisZone(TAZ)information,andthecity'scensusdata.Forthisnewstudy,EPSwillincorporatemanyotherdatasourcesinadditiontothedatasourcesusedprior.EPSwillcompileallofthisdataandputitintooneGISdatabaseforanalysis.EricKecknotedthattheEPSstudywillgowellbeyondWhattheL/EWWTPhasusedinthepasttoanalyzepopulationgrowth;andthisstudywillultimatelyhelpwhomeverselectedtocomplete?owprojections.MarkRelphaskedChongtoreachouttothesanitationdistrictstomakesurethattheyareinvolvedinthisprocess.ACTIONTAKEN—TheSupervisoryCommitteeapproved[/15WWTP’srecommendationofaprofessionalservicesagreementwithEconomicandPlanningSystems,Inc.,intheamountnottoexceed$40,610.00toconductapopulationstudyfortheIJEWWTPservicearea.EricKeckmoved,DaveHendersonsecondedallayes,nonays,approvedbyallIJEWWTPstaffwillpresenttotheEnglewoodCityCouncilforconsideration.WorkforceAlignmentandStrategyAdvisementServices—CindyGoodburnCindyGoodbumbrie?ydiscussedtheWorkforceAlignmentandStrategyAdvisementServicesProject(formerlyknownastheSta?ingandSpaceNeedsAssessment)withtheCommittee,Themainchangestothescopeoftheprojectweretochangeitstitle,removespaceneedsfromthescopeofwork,andseparatethescopeofworkintothreeseparatetasksaspartofTaskOrdercontract.ThethreetasksnowgiveL/EWWTPoptions,attheendofeachtask,todecidewhethertoproceed.CindyaskedtheCommitteetodelayconsiderationofthisitemuntilshecoulddiscussinfurtherdetailwithJohnKuosman,L/EWWTPDirector.Cindyproposedvotingelectronicallyonthisactionitem.EricKeckaskedfortheCommittee,priortovoting,tobeprovidedwithanamendedscope,anarrativesummaryofthechangesmadefromthetimetheCommitteefirstsawthepresentation,andasummaryofthekeyaspectsofthedeliverablesfromCarollo.ACTIONTAKEN—EricKeckmadeamotiontohavetheUHWWTPstaffpreparethematerialsrequestedbytheSupervisoryCommitteeandsentelectronicallytotheCommittee.OncethereceivedtheSupervisoryCommitteewillvoteonthesematerialstoallowtheWorkforceAlignmentandStrategyAdvisementServicesProjecttomoveforwardtotheEnglewoadCityCouncilforapproval,soresultscanbesharedattheAugustJointCouncilmeeting.MarkRelphsecondedallayes,nonays,approvalbyulLPage 230 of 319 MINUTESSUPERVISORYCOlVllV[[TTEEMEETINGMay18,2017Page3of7III.InterceptorOwnershipDelineationIntergovernmentalAgreement—ChongWooChongWoodiscussedtherecommendationtoformalizetheagreementsbetweenL/EWWTP,theCityofEnglewood,theCityofLittleton,andtheValleySanitationDistrict.PreviousdocumentationdidnotclarifythedelineationofownershipoffourinterceptorscomingontotheLIEWWTPsite.TheL/EWWTPstaffandHill&RobbinshavebeenworkingwiththeCityofLittleton,CityofEnglewood,andtheValleySanitationDistricttodelineateownershipoftireinterceptors.L/EWWTPstaffwouldliketo?nalizetheagreementwiththeCityofEnglewood(CityofLittletonalreadyapprovedbyseparateordinance)andValleySanitationDistrictinJune2017.EricKeckthankedtheL/EWWTPstaffforprovidingexhibitsshowingtheinterceptorsandpipelines.ACTIONTAKEN—TheSupervisoryCommitteeapprovedtheMemosofUnderstanding(MOUS)withValleySanitationDistrictandtheCityoflfnglewood,whichdelineatetheOwnershipoftheInterceptorLines,whichconveyflowtotheI./EWWTP.DaveHendersonmoved,MarkRelphsecondedallayes,nonays,approvedbyall.L/EWWTPstaffwillpresenttotheEnglewoodCityCouncilforconsiderationa?erapprovalsbytheWaterandSewerBoard.INFORMATIONALITEMSforPresentationUseTaxApplicabilityAssessmentStatusUpdate—MattMontgomeryMattMontgomerydiscussedhis?m1’sresearchonusetaxes.Hill&Robbinshasconcludedthat,asamatteroflaw,theCityofEnglewoodmayimposeusetaxesonitselfandtheCityofLittletonderivedfromthebuildingandconstructionmaterialsfurnishedbyindependentcontractorstotheL/EWWTP.Mattnoted,however,thatwhetherornottheCityofEnglewoodshouldimposethesetaxesontheCityofLittletonanditselfarepoliticaldecisionswithinthediscretionoftheEnglewoodCityCouncilunderitsArticleXXpowers.Hill&Robbins,ascounseltotheL/EWWTP,cannotopineonthispoliticalquestion.EricKeckandMarkRelphappreciatedtheworkHill&RobbinscompletedonthiissuesincetherehasbeensomerecentdebatewithintheCityofEnglewoodinrelationtoUseTax.DennisStowepointedoutthatmostoftheUseTaxcomesfromoumideofthetwoCitiesthemselves.DavidRobbinssuggestedreleasingtheUseTaxMemotobothCityManagersandtheirrespectiveCityAttorneyssotheycoulddecidehowtomoveforwardwiththeirCouncils.BiogasApplicationFeasibilityStudyStatusUpdate-ChungWooChongWoodiscussedtheprogresssincelastmonth’smeeting.TheBiogasApplicationFeasibilityStudyisdesignedtoidentifytechnicalandeconomicopportunitiestoextractrenewableenergyfromtheL/EWWTPdigestionprocess.InApril,CarolloEngineersInc.conductedaworkshoptopresentitsfindingstoL/EWWTPstaff.Carollorecommendedpurchasing,constructing,andoperatingadigestergas-conditioningskidtopurifydigesterbiogastoachieverenewablenaturalgasquality.CarollobelievesthatthisaltemativewillgivetheL/EWWTPtheabilitytosellgasbacktoXcelEnergy,viathenationalpipelinesystemlocatedalongtheNorthsideoftheLIEWWTPpropertyboundary;andthattheL/EWWTPwillseeafullreturnoninvestmentwithin4-7years.Carollodevelopedaninitialcostestimateforthecapitalinvestmentintherangeof$8milliondollars.ThisprojectiseconomicallyfeasibilitybecauseofincentivesprovidedbytheFederalRenewableFuelStandard.RenewableIdenti?cationNumbers(RINs)aregeneratedandtheirproofoftitleistrackedfromtheproducertoPage 231 of 319 MINUTESSUPERVISORYCOMMITTEEMEETINGMay18,2017Page4of7theenduser.RINsaremonetizedatthetimeofsaleandretiredwhentherenewablenaturalgasisconsumed.ThemonetizationoftheseRlNsallowsforthespeedyreturnofcapitalandoperatinginvestments.IfL/EWWTPwereabletoassumethecun'entrateoftheRINs,theplantwouldseeareturnoninvestmentwithin4years.TheCommitteefurtherdiscussedfundingoptionsforengineeringdesign,legalsupport,brokerageservices,andconstruction.TheL/EWWTPstaffplanstopresentabusinesscasereporttotheCommitteeinJune,totheEnglewoodCityCouncilStudySessioninJuly,andtobothCityCouncilsduringtheAugistJointCouncilmeeting.StrategicOperatingPlan(SOP)StatusUpdate—ChungWooChongWoodiscussedthedevelopmentofa5-yearStrategicOperatingPlan(SOP)thatisdesignedtoprovideL/EWWTPwithaholisticapproachtomeetingthecurrentRegulationNo.85limitsandtoputL/EWWTPinagoodpositiontomeetRegulationNo.31inthefuture.TheSOPintendstoprovidearoadmaptoachieveoperationalexcellence,manageassets,andidentifycapitalimprovementstosustainablyprotectandextendresourcestoensurethelivelihoodofourcommunitiesandtheenvironment.AdditionallytheSOPwilladdresshighestriskofagingassetsandinfrastructure,operationalchallenges(maintenanceandstaffresources),chemicalandenergyintensivenessofprocesses,andresourcerecoveryopportunities.L/EWWTPstaffisaskingforsupportfromtheCommitteetomoveforwardinissuinganRFP(RequestforProposal)assoonaspossible,tohelpselectaquali?edengineeringconsultanttoconducttheproposedSOP.EricKecksuggestedincludinglanguageintheRFPallowingforpolicymaker‘sdirectiontoin?uencethescopeofwork.MarkRelphsuggestedaddinglanguageexplaininghowthepopulationstudyandplantcapacityshouldbecoordinatedintothisproject.RECOMMENDEDACTION—TheSupervisoryCommitteesapportedl./EWWTPstaffmovingforwardwiththeRequestforProposal(RFP)toselectaqualifiedengineeringconsultanttoconducttheproposedStrategicOperatingPlan.EricKeckmoved,MarkRelphsecondedallayes,nonays,approvedbyall.RegulatoryUpdates——DanDeLaughterDanDeLaugl1terupdatedtheCommitteeontheWaterQualityForumWorkgroupprogressandtheupcomingRulemakingHearingprocess.ThemainworkgroupforReg.85hasconcludedandL/EWWTPwassuccessfulintakingcertaintopicsoffofthetable,oneofthosewasthereductionoftheTIN(TotalInorganicNitrogen)limit.ThecurrentproposaltheWaterQualityForumWorkgroupismovingtowardsisanincentiveprogramforearlyreductionsbelowReg.85limits,whichwouldmakepennitteeseligibleforanextendedcompliancescheduleforfutureReg.31limits.Itwouldbeavoluntaryincentiveprogram;L/EWWTP,MetroWastewater,CentennialandtheCityofBoulderhaveallbeenheavilyinvolvedwiththedetailsofthisprogram.RegulatoryproposalsareduetotheWaterQualityControlCommission(WQCC)officebyMay26,2017.TheRulemakingHearingisscheduledforOctober10,2017.PartystatusrequestsareduebyAugust7,2017.DannotedthattherewouldlikelybesomelegalcostsassociatedwiththeRulemakingHearinginOctober;thelegalcostswillbedependentonhowmanypartiesgotinvolved.TheColoradoWastewaterUtilityCouncil(CWWUC)seemstobeleaningtowardssupportingthewastewatergroup.DanrecommendsthatL/EWWTPparticipateintheRulemakingHearingbyrequestingpartystatusinAugustandcontinuetoparticipateinworkgroupmeetings.Page 232 of 319 MINUTESSUPERVISORYCOMIVIITTEEMEETINGMay18,2017Page5of7DavidRobbinsdiscussedhowthisisacriticalissueforL/EWWTPbecausephosphorusandnitrogenremovalaregoingtoeventuallyrequirelargecapitalandoperatingexpensesforcompliance.TheworkthatDanisdoingisintendedtoprovidetheframeworkthatwillallowthedeferralofsomeofmajorregulatorychangesthatcouldpotentiallycostL/EWWTPmorethanahalfabilliondollars.TheL/WWWTPisengagedintheseprocessesandworkgroupstotrytoscienti?callyguidethemtowardlimitingL/EWWTP’sexposureforaslongaswecanwhilestillbeingmindfulofdienetenvironmentalimpacts.DanupdatedtheCommitteeregardingthestatusoftheRulemakingHearingprocessforReg.34andReg.35,whichistheSanJuan/GunnisonBasinRulemakingHearing.L/EWWTPpreviouslyrequestedpartystatusandsubmittedaResponsivePrehearingStatementforthishearing.Atthishearing,thereweresomeproposalsforsite-speci?ctemperaturestandardsandsomeproposalstoremovethewatersupplyusefromsegmentsoftheriver;bothofwhichareofinteresttoL/EWWTP.TheWQCDisnowproposingtokeepthechloridevalueinplaceandremovethesulfatestandardifthewatersupplyusewasremoved.L/EWWTPisinterestedintheseproposalsbecausethesetwoparametersarecontainedinthemetalsaltsthatL/EWWTPmayaddforfuturephosphomsremoval,anditmaybepossibletoremovethewatersupplyuseclassi?cationdesignationfromportionofSegment14future.Inrelationtothesite-speci?ctemperaturestandard,L/EWWTPwasconcernedthatdecisionsbytheWQCCinthishearingcouldsetaprecedentonhowtheWQCDwoulddealwiththisissuestate-wide.Wehaveexpressedourviewsandnoadditionalworkisneededforthishearingatthistime.DanDeLaughterupdatedtheCommitteeondownstreampennitsthatwererecentlyissued.L/EWWTPwasoriginallyissuedwitha5mgdreservecapacity;thesewere?owsfrompotentialdownstreamdischargersthatweremodeledwithL/EWWTPinordertocalculateL/EWWTP’sappropriatepermitlimits.Sincethattime,L/EWWTPhashadextensivenegotiationswiththeWQCDtoremovethisconceptfromL/EWWTP'spermit.TheWQCDrecentlyissuedtwoindustrialpennitswhichhada5mgd“allotment”.Thedifferencebetweenthe“allotment”andreservecapacityconceptsisnowtheWQCDhasidenti?edspeci?cdischargers,butsomeoftheidenti?edpermitsshouldnotbegivenanyassimilativecapacity,particularlyforfacilitiesdischargingundergeneralpermitsorthosethathaveonlyappliedforpreliminaryef?uentlimits(PELs).ltisL/EWWTP’spositionthatthesedownstreampennitsshouldnotbeincludedinthemodelingforourpermitlimits.L/EWWTPstaffhascommentedextensivelyonthesepermits,andtheWQCDhassinceagreedtoremovethesefacilities’?owsfromL/EWWTP’spermit.Thebiggestwinfromthisisthattheconceptofreservecapacityisdead.DavidRobbinsnotedhowHill&RobbinsandL/EWWTPstaffmountedasigni?cantcampaigntocollaboratewithotherdischargersaroundthestatetojoininandwritelettersopposingthisconcept.DanmentionedthatforthepermitsthatareoktomodelwithL/EWWTPsomespeci?cpollutants(thosethatarenotpollutantsofcommonconcernorforwhichthedownstreamfacilitieshavestringentlimitations)downstreamfacilityflowswillnotbeincludedinthecalculationsforourpermit.Theseparametersincludecyanide,temperature,andTIN.ThisisimportantbecauseL/EWWTPissubjecttoBarr-Miltonregulation,andsubjecttotheSegment14TotalMaximumDailyLoad(TMDL)forTIN;sowhennewfacilitiescomeinfordischargepermitstheyareessentiallynotgivenaloadallocation.DannotedaquickupdateonTemperature.TheWQCDhadreachedouttoL/EWWTPandMetroWastewaterregardinga?shstudyontheJohnnyDarter,whichisoneofthemoresensitivewarmwater?sh.DanmaybecomingbacktotheCommitteelookingforsupportonthisstudy.Fundsareallocatedinthe2017EnvironmentalComplianceBudgetforthisstudy.DandiscussedhowthisstudywouldbecompletedbyColoradoStateUniversity(CSU).EricKeckaskedifwehavealreadydoneastudyontheJohnnyDarter.DavidRobbinsPage 233 of 319 NHNUTESSUPERVISORYCOMMITTEEMEETINGMay18,2017Page6of7clari?edthattheymostrecentstudywascompletedonevaluatingthe?shscienceonthespeciesknowntoexistinSegment14.NewandUpdatedConnectorAddendumsStatusUpdate—TimGrossbachTimGrossbachupdatedtheCommitteeonthestatusoftheConnectorAddendums.AllbutoneoftheEnglewoodConnectorServiceAgreementAddendumswereapprovedbytheEnglewoodCityCouncilonApril17,2017.TheexceptionwastheCherryvaleSanitationDistrictAddendum,whichwasjustrecentlysigned.TheCherryvaleAddendumwillbepresentedtotheEnglewoodCityCouncilforfirstreadingonJuly5,2017.TimnotedthatfouroftheAddendumsareintheprocessofbeingrevised.Thesefour,CherryHillsVillageSanitation,SouthArapahoeSanitation,SouthgateSanitationandtheCityofSheridan,wereoriginallysignedandretumedtoL/EWWTPwithoutanycomment.Sincethen,otherConnectorAddendumshaveincludedadditionalchanges,andthereforethesefourneedtobeupdatedtomakethemconsistentwiththeotherAddendums.TheCherryvaleSanitationDistrictAddendumandthefourrevisedAddendumswerepresentedtotheEnglewoodWater&SewerBoardonMay9,2017.TheywillnotbeofficiallyapproveduntiltheWater&SewerBoardMeetingminutesareapprovedonJune13,2017.TheCherryvaleSanitationDistrictAddendumandthefourrevisedAddendumswillbepresentedtotheEnglewoodCityCouncilforfirstreadingonJuly5,2017andforsecondreadingonJuly17,2017.AllbutoneoftheLittletonConnectorServiceAgreementAddendumswereapprovedbytheLittletonCityCouncilonsecondreadingonMay16,2017.TheexceptionwastheKenCarylRanchAgreementAddendum,whichwasjustrecentlysigned,andincludesanInterpretativeMemorandumprovidedbytheKenCarylRanehlegalgroup.ThisInterpretativeMemowaspresentedtoHill&Robbinsforlegalreview,andtheircommentswereincorporatedintotheagreement.KenCarylRanchAgreementAddendumwillbepresentedtotheLittletonCityCouncilforfirstreadingonJune27,2017andforsecondreadingonJuly18,2017.MarkRelphconfirmedthattheJune27”‘LittletonCityCouncilmeetingwillbearegularsession.TheMunicipalCodewasapprovedbybothCityCouncilsinearlyAprilforfirstreading.Asthenextstep,EPArequiresa30-daypublicnoticeperiod.L/EWWTPstaffdoesnotknowwhenEPAwillnoticetheMunicipalcodechanges.DavidRobbinssuggestedsubmittingtoEPAashortletteraskingEPAtonoticethecodechanges.LIEWWTPEnergyUsageGraph—JimTallentJimTallentbrie?ydiscussedtheLIEWWTP'senergyusagegraphwiththeCommittee.L/EWWTPisactivelyinitiatingelectricalconservationprograms.ThroughApril2017L/EWWTPhasreduceditselectricalusageby2.8%fromthesameperiodlastyear.Thisis12%lowerthanthebaselineyearof2007.L/EWWTPisalwayslookingatwaystolowerelectricalusagetoreducethecostpertreatmentunit.TheL/EWWTP’sannualelectricalexpendituresarecurrentlyestimatedat1.2milliondollars.Page 234 of 319 MINUTESSUPERVISORYCOMMITTEEMEETINGMay18,2017Page7of7JointCouncilActionItemsStatusUpdate—DennisStoweDennisStowediscussedupdatesontheJointCouncilActionItemsfromthemeetingonMarch9,2017.Denniscon?rmedthenextJointCouncilMeetingwouldoccuronThursday,August17,2017.BothMarkRelphandEricKeckcon?rmedthisdatefortheirrespectiveCouncils.DennisnotedtheUseTaxMemocompetition.DennisupdatedtheCommitteeontheBennettproperty.Thereisanappraisalbeingcompletednowandwillbereadywithinacoupleofweeks.JohnKuosmanisreviewingthepreliminaryleasefromanenergycompanyinterestedinusingthepropertyforasolarfarm.L/EWWTPshouldbeabletomoveforwardwithevaluatingthatsoon.Dennismentionedtheupcomingplant,farmandindustrytours.BrendaVamernotedthatL/EWWTPstaffarecurrentlysolidifyingtimelinesforthesetoursandplanonsendingoutaninvitationtothetwoCityManagerstodistributetotheirCouncilswhenthesetimesare?nalized.DennisnotedtheapprovalforthePopulationStudyfromthismeeting,whichwillmoveusforwardonthe?owandloadstudy.FeedbackonNewLayoutofMonthlyReport—-DennisStoweOnbehalfofJohnKuosman,DennisStoweaskedtheCommitteeforfeedbackonthenewlayoutoftheMonthlyProgressReport.EricKeckstatedthatheappreciatedhavingthematerialssentoutaheadoftime,asthisiscriticalfortheCommittee’sunderstanding.MarkRelphagreed.EriclikedhowL/EWWTPistakingadditionaltimefortheinformationalitemsbecausethishaspromptedquestionsfromtheCommittee.Speci?cally,EricnotedhowimportantitwastohearfromDanDeLaughterbecausethetopicsheisinvolvedwithhavelargecostimplicationsiftheyarenotmanagedcorrectly.FeedbackonSlateCommunications—BrendaVarnerBrendaVarneraskedEricKeckandMarkRelphifitwouldbeappropriatetoreachouttothetwocities‘mayorsandaskfortheirfeedbackinregardstotheLIEWW'l'P’srebrandingeffortscurrentlybeingconductedbySlateCommunications.BothEricandMarkagreedthatthiswouldbeacceptable.IV.ADJOURNMENTThenextSupervisoryCommitteemeetingisscheduledforThursday,June15,2017.Thismeetingwillbeheldat9:00amattheLittleton/EnglewoodWastewaterTreatmentPlant.Adjoumedat10:12amRecordingSecretarySignatureBrendaJ.erThe1/11‘WWTPSupervisoryCommitteeapprovedtheWorkforceAlignmentandStrategyAdvirementServicesAgreementwithCorollaEngineers,Ine.,intheamountof$100,000,viaemailvoteonMonday,May22,2017.EricKeck,MarkRelplt,DaveHenderron,BrentThompsonallayes,nonays.The1/5WWTPSupervisoryCommitteeapprovedthesemeetingminutesviaemailanThurrdoy,JuneI,2017andFriday,June2,2017.EricKeck,MarkRelph,DaveHenderson,BrentThompsonallayes,nonayr,minutesapproved.Page 235 of 319 LITTLETON/ENGLEWOODWASTEWATERTREATMENTPLANT‘*3’0/CW°fLnttletonEnglewood(308)7612630FAX762»2S2?MINUTESSUPERVISORYCOMMITTEEMEETINGSeptember28,20178:30amATTENDING:SupervisogCommittee:ErieKeckEnglewoodCityManagerMarkRelphLittletonCityManagerDaveHendersonEnglewoodPublicWorksDirectorKeithReesterActingLittletonPublicWorksDirectorL/EWWTPandCityStaff:AlisonMcKenneyBrownEnglewoodCityAttorneyMattMontgomeryHill&Robbins,L/EWWTPAttorneyTomBrennanEnglewoodUtilitiesDirectorJohnKuosmanL/EWWTPDirectorBlairCorningL/EWWTPDeputyDirectorofStrategicProgramsJeniferDoaneL/EWWTPDeputyDirectorofBusinessAdministration&CommunicationsKurtCarsonL/EWWTPDeputyDirectorofOperations&MaintenanceSolutionsBrendaVamerL/EWWTPGovernmentRelationsSpecialistChongWooL/EWWTPCapitalProject&AssetLeadershipManagerDerikCaudillL/EWWTPBeyondComplianceProgramsManagerJimTallentL/EWWTPStrategicWorkforceAdvisorKacieAllardL/EWWTPCommunications&DataSupervisorGUESTS:CynthiaLanePlatteCanyonWater&SanitationDistrict,AssistantManagerI.IntroductionJohnKuosman,Littleton/EnglewoodWastewaterTreatmentPlant(L/EWWTP)Director,initiatedtheSeptemberSupervisoryCommittee(Committee)meeting.AugustCommitteemeetingminuteswereapprovedviaemailonAugust30,2017.II.Branding,NameandLogoJohnKuosmanupdatedtheCommitteeontheL/EWWTPrebrandingefforts.TheL/EWWTPstaffnotedthatchangesweremadetothenameandlogobasedonfeedbackfromJointStudySessionandPage 236 of 319 MINUTESSUPERVISORYCOMIVHTTEENEIETINGSeptember28,2017Page20|‘5L/EWWTPstaff.JeniferDoanereviewedthepresentationoutliningtheseproposedchanges.TheL/EWWTPstaffbroughtthereceivedfeedbacktotheLIEWWTPRebrandingAmbassadors,completedadditionalsurveys,andreachedouttomorestakeholders.Theresultsshowedaneedforanidenti?erattheendofthename,anhistoricalcomponent,andacompromisewiththepastandfuture.L/EWWTPstaffaskedtheCommitteeforitsfeedbackonthenewrecommendationsfortl1enameandlogo.MarkRelphandEricKeckdiscussedthesuggestionstheyheardfrombothcities’CouncilswiththeL/EWWTPstaff.TheCommitteediscussedthetimelinefortherebrandingrollout.TheCommitteerecommendedtheLIEWWTPstaffcomposeamemototheCityManagersfortheirdistributiontoCouncils,whichwillexplainhowstaffarrivedatthesenewideasandtheimplementationtimeline.III.StrategicOgeratingPlan(SOP[JohnKuosmansummarizedpastdiscussionsregardingtheStrategicOperatingPlan(SOP)withbothCouncilsattheJointCouncilStudySessioninAugustandtwoindividualStudySessionsearlierthisweek.JohnaskedtheCommitteeforitsapprovaltotaketheengineeringcontractforwardtotheCityofEnglewoodCouncilforapprovalonOctober16,2017.MarkRelphgavekudostoChangWooandJohnKuosmanforpresentingtotheLittletonCityCouncilonTuesday,September26,2017.EricKeckreiteratedMark’scommentsandnotedhoweasyitwastofollowthepresentationtotheEnglewoodCityCouncilonMonday,September25,2017.ACTIONTAKEN—TheSupervisoryCommitteeapprovedI/EWWTP’srecommendationtomoveforwardwithacontractwithCarolloEngineers,Inc.,fortheStrategicOperatingPlan(SOP),intheamountof$500,000.00.MarkRelphmoved,EricKeckseconded,allayes,nonays.TheL/EWWTPstajfwillpresenttheSOPtotheEnglewoodCityCouncilforconsiderationonOctober16,2017.IV.BioastoRenewableNaturalGasGPro'ectJohnKuosmansummarizedpastdiscussionsregardingtheBiogastoRenewableNaturalGas(RNG)ProjectwithbothCouncilsincludingtwoindividualStudySessionsinJuly,theJointCouncilStudySessioninAugust,andtwoindividualStudySessionsearlierthisweek.JohnaskedtheCommitteeforitsapprovaltotaketheengineeringcontractforwardtotheCityofEnglewoodCouncilforapprovalonOctober16,2017.ACTIONTAKEN-TheSupervisoryCommitteeapprovedIJEWWTP’:recommendationtomoveforwardwithaprofessionalservicesagreementwithCarolloEngineers,Inc.,fortheBiogastoRenewableNaturalGas(RNG)Project,intheamountof$380,400.00.MarkRelphmoved,EricKeckseconded,allayes,nohays.TheUEWWTPstaffwillpresenttheBiogastoRenewableNaturalGas(RNG)ProjecttotheEnglewoodCityCouncilforconsiderationonOctober16,2017.Page 237 of 319 MWUTESSUPERVISORYCOMMITTEEIVEEETINGSeptember28,2017Page3V.VI.VII.VIII.ot'5Kiowa/BennettPropergDispositionJohnKuosmansummarizedthekeydiscussionpointsoftheKiowa/BennettPropertyDispositionPresentationfromtheAugustJointCouncilStudySession.JohnaskedeachCommitteememberifheorshehadreceivedanyfurtherfeedbackfromtheCouncils.BothEricKeckandMarkRelphbelievedthattheCouncilswouldliketoholdontotl1epropertyandtosellatalaterdate.TheCommitteerecommendedthatL/EWWTPstaffcontinuethecurrentleasingstructure,holdontotheproperty,andnotactivelyseeksolarorwindleasing.TheCommitteealsorequestedthatL/EWWTPstaffcomposeasummarydocumentfortheCityManagerstodistributetotheCouncils.2018L/EWWTPFiscalYearBudgetJohnKuosmansubmittedabudgetexplanationmemotoeachCityManagerinJuly2017,ontheproposed2018L/EWWTPBudget.JohnclarifiedthattheCityofEnglewoodelectedtoleaveitsportionoftheBiogastoRenewableNaturalGas(RNG)Projectinthe2018L/EWWTPBudget;andtheCityofLittletonelectedtoremovethebudgetcostforitsportionoftheproject.MarkRelphandEricKeckconfirmed.ACTIONTAKEN-—TheSupervisoryCommitteerecommendedthe2018UEWWTPBudgetbebroughtforwardtotheEnglcwoodCityCouncilforapproval.EricKeckmoved,MarkRelphseconded,allayes,nonays.The2018L/EWWTPBudgetwillbepresentedtotheEnglewoodCityCouncilforconsiderationonfirstreadingonOctober2,2017,andforconsiderationforsecondreadingonOctober16,2017.ValmetAnalyzerPurchaseJohnKuosmanupdatedtheCommitteeabouttheLIEWWTPstaffsworktoimprovethedewateringprocess.Thepurchaseofanewinstrument,theValmetAnalyzer,willallowforoptimalpolymerdosinginL/EWWTP’sdewateringprocess.ThisnewinstrumentshouldsavetheL/EWWTPapproximately$57,750inpolymercostsannually.BlairCorningdiscussedhowthisprojectisagreatdealandveryimportanttoL/EWWTPstaff.Thesavingsthatcanberealizedandthepay-backperiodofoneyeararebene?cialtodieorganization.Mostimportantly,thisprojectspeakstowardsL/EWWTP’scommitmenttoinnovation.2018ColoradoStateUniversiCSBiosolidsResearchProosalJohnKuosmanreviewedhisdecisiontorenewtheintergovernmentalagreement(IGA)betweenL/EWWTPandCSUtostudyBiosolidsapplication.Pursuanttoordinance,theLIEWWTPDirectorcanrenewtheIGA.Page 238 of 319 MINUTESSUPERVISORYCOMNHTTEEMEETDVGSeptember28,2017Page4of5BlairCorningdescribedCSU’sproposedstudiesfor2018.CSUwillcontinueongoingstudiesofthemeasurementofPhosphorus(P)insoil.Thisyear,CSUwillbeginusingamodelingtooltoquantifyPinthesoilanditslong-termimpacttothesoil.ThesestudieswillbeusedbytheEnvironmentalProtectionAgency(EPA)andmanyresourceinstitutionsforreliableresearchdata.Thisyear’stotalcostis$122,000;lastyear’stotalcostwas$117,000.D(.DiscussionoflnformationnlItems:UpdateonDigesterRoofProject:EricKeckaskedforanupdateontheDigesterRoofProject.ChongWoodiscussedthestatusofthisprojectwiththeCommittee.AsummaryofthestatusofthisprojectwillbeaddedintothesummaryupdateforbothCityCouncilsfortheOctobermeeting.ReguiredReporting:JohnKuosmandiscussedthein?uent?owandloadsummaryforthemonthofAugust2017.Themeasured?owtotheL/EWWTPaveraged21.1mgdinAugust2017,whichwasanincreaseof0.2fromJuly2017.Themeasured?owsplitbetweentheCitiesofLittletonandEnglewoodrespectivelywas42.2/57.8percent.FutureJointCouncilStudySessionRecommendation:JohnKuosmandiscussedanalternativeapproachtotheJointCouncilStudySessions.AccordingtotheJointUseAgreement,L/EWWTPisrequiredtoholdonejointmeetingperyearwithbothCouncils.JohnoutlinedthepossibilityofutilizingindividualCityCouncilStudySessionswitheachCouncilinadditiontotheannualmeeting.TheCommitteediscussedthisalternateapproachandthetimingofthearuiualmeeting.MarkRelphsuggestedusingthemonthofJulyfortheannualmeetingtoassistwiththebudgetingprocess.TheL/EWWTPstaffwillcompileaproposedschedulefortheCommittee’sreviewbeforesubmittingtotheCouncils.EnergyInitiatives:EricKeckrequestedasummaryofwastewatertreatmentplantenergy-savinginitiativesthatareunderwayattheL/EWWTP.JohnKuosmancon?nnedthatoneoftheinitiativesoftheL/EWWTPistogettoenergyneutrality.TheL/EWWTPhasanenergymanagementcommitteethatwillbeabletocompileasummaryforEricfor2018.UpdateonRegplatogCompliance:MattMontgomeryprovidedtheCommitteewithanupdateontheworkheandDanDeLaughterhavebeendoingwiththeWaterQualityControlDivision(Division)andotherwastewaterentitiestodeveloparegulatoryframeworkthatcouldpotentiallydefraycostsforcomplyingwithnutrientcriteriaforRegulation31.ThisproposalisanincentiveprogramthatwouldallowentitieswhomeetthePage 239 of 319 MINUTESSUPERVISORYCOMMITTEEMEETINGSeptember28,2017Page5of5nutrienttreatmentgoalsofRegulation85beforemandatorydeadlinestoaccrueadditionaltimetomeettheRegulation31nutrientgoals.ThegroupworkingonthisproposalplanstomeetonOctober2,2017,beforetheOctober9,2017hearing.Ifthisproposaloranotherincentiveprogramisapproved,thismayallowL/EWWTPtoaccrueadditionaltimetomeetcertainRegulation31nutrientrequirements.TheL/EWWTPStrategicOperatingPlan(SOP)includesthisanalysisaspartofindividualprojectbusinesscases.X.AdjournmentThenextSupervisoryCommitteemeetingisscheduledforThursday,October19,2017.Thismeetingwillbeheldfrom8:30am~10:00am,attheLittleton/EnglewoodWastewaterTreatmentPlant.Adjournedat10:13amRecordingSecretarySignatureBaJ.VarnerTheL/EWWTPSupervimryCommitteeapproved(IreSeptember28,2017meetingminutes‘viaemailonMonday,October2,2017.EricKeck,MarkRelplt,DaveHenderson,andKeithReesterallayes,nonays,minutesapproved.Page 240 of 319 COUNCIL COMMUNICATION TO: Mayor and Council FROM: John Kuosman DEPARTMENT: WWTP DATE: October 16, 2017 SUBJECT: L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project DESCRIPTION: L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project RECOMMENDATION: The Littleton / Englewood Wastewater Treatment Plant (L/E WWTP) Supervisory Committee and staff recommend that City Council approve, by motion, a professional services agreement with Carollo Engineers, Inc. to conduct the design engineering and contractor procurement services for the L/E WWTP Biogas to Renewalable Natural Gas (RNG) Project in the amount of $380,400. PREVIOUS COUNCIL ACTION: On January 3, 2017, Englewood City Council approved an award of contract to Carollo Engineers, Inc. in the amount of $61,500, to conduct a Biogas Application Feasibility Study. SUMMARY: In 2017, the Littleton/Englewood Wastewater Treatment Plant (L/E WWTP) initiated a Biogas Application Feasibility Study. The goal of the study was to evaluate collaborating with neighboring industries in order to identify a Biogas to Renewable Natural Gas (RNG) Project that would develop a renewable energy product, create a potential revenue source, and highlight the L/E WWTP as a community resource. Carollo Engineers was awarded a contract to conduct the feasibility study and included an economic analysis of various alternatives. The project alternatives investigated included: • Conversion of digester gas for onsite electrical power generation • Conversion of digester gas to compressed natural gas (CNG) for vehicle fuel • Conversion of digester gas to pipeline quality natural gas (PNG) to be injected into utility service grid Based on an analysis, a pipeline injection natural gas project is the most economical and feasible for project implementation. The project will consist of the purchase and construction of a clean-up skid to purify the digester gas to renewable natural gas quality, construction of a new gas pipeline, and construction of the interconnection equipment to the Xcel Energy pipeline grid. Recommendations for project financing including third party financing options, broker services for renewable fuel credits, and the Xcel Energy interconnection agreement are tentatively planned for January 2018. Page 241 of 319 ANALYSIS: Carollo’s scope for design and procurement services will consist of: • Design of pipeline to connect existing biogas system (digester complex) to new biogas conditioning system • Sizing and specification of biogas conditioning system located adjacent to existing digester complex on slab on grade foundation • Sizing and specification of thermal oxidizing flare • Coordination of Xcel Energy interconnection requirements • Cost estimating • Procurement support for construction contractor, broker services, and Xcel Energy agreement • Third Party Financing Carollo is a nationally recognized environmental engineering firm specializing in the planning, design, and construction management of water and wastewater facilities. The firm is currently ranked within Engineering News Record’s top 15 firms for water and sewer/wastewater companies. Carollo has provided biogas engineering services for other municipalities and has the resources and knowledge to provide the services proposed. FINANCIAL IMPLICATIONS: The Biogas to Renewable Natural Gas (RNG) Project – Design Engineering and Contractor Procurement Professional Services in the amount of $380,400 will be partially allocated from existing 2017 budget availability. The approved 2017 budget for the WWTP included $1,496,000 for professional services. Through September, $406,175 of professional services have been expended to date and there is adequate funding available to fund the portion of work that will be completed in 2017. Funding for remaining work to be completed in 2018 has also been identified within the 2018 budget request. ALTERNATIVES: None identified. CONCLUSION: The Biogas to Renewable Natural Gas (RNG) Project will allow the wastewater plant to beneficially and fiscally responsibly reuse the digester gas product that is now creating significant greenhouse gas emissions. In the end, the project will allow the conversion of a wastewater product into a natural gas commodity that be leveraged to reduce the plants operating costs into the future. ATTACHMENTS: Carollo Contract Carollo Biogas Use Applications Report Biogas Presentation September 28, 2017 Supervisory Committee Meeting Minutes Page 242 of 319 Cl:C.EngiewoociPROCUREMENTDIVISIONPROFESSIONALSERVICESAGREEMENTContractNurnhnrFSAI17-26PipelineInjectionDulgnServices5380.400(nottoexceed]ThisProfessionalservicesAgreement(the"Agreement")ismadeasofthis17thdayofAugust.2017,(the“EffectiveDate")byandbetweenCarolloEngineers,inc..aDelawarecorporation("Consultant").andTheCityofEngiewood.Colorado,amunicipalcorporationorganizedunderthelawsoftheStateofColorado("City").CitydesiresthatConsultant.fromtimetotime.providecertainconsultingservices,systemsintegrationservices.dataconversionservices.trainingservices.andlorrelatedservicesasdescribedherein,andConsultantdesirestoperfonnsuchservicesonbehalfofCityonthetermsandconditionssetforthherein.inconsiderationoftheforegoingandthetenshereinaftersetforthandothergoodandvaluableconsideration.thereceiptandsuf?ciencyofwhichareherebyacknowledged.thepartieshereto.intendingtobelegallybound.agreeasfollows:1.De?nitions.Thetermssetforthbelowshallbedefinedasfollows:(a)‘intellectualPropertyRights"shallmeananyandall(bywhatevernameortermknownordesignated)tangibleandintangibleandnowknownorhereafterexisting(1)rightsassociatewithworksofauthorshipthroughouttheuniverse.includingbutnotlimitedtocopyrights.moralrights.andmask-works.(2)trademarkandtradenamerightsandsimilarrights.(3)tradesecretrights.(4)patents.designs,algorithmsandotherIndustrialpropertyrights,(5)allotherintellectualandindustrialpropertyrights(ofeverykindandnaturethroughouttheuniverseandhoweverdesignated)(includinglogos,"rental"rightsandrightstoremuneration).whetherarisingbyoperationoflaw.contract.license.orotherwise.and(6)allregistrations.initialapplications.renewals.extensions.contlnuatlons.divisionsorreissueshereofnoworhereafterinforce(Includinganyrightsinanyoftheforegoing).(b)“WorkProduct‘shallmeanallpatents,patentapplications.inventions.designs.maskworks.processes.methodologies.copyrightsandcopyrightableworks.tradesecretsinciudingcon?dentialInformation.data.designs.manuals,trainingmaterialsanddocumentation.formulas.knowledgeofmanufacturingprocesses.methods.prices.?nancialandaccountingdata.productsandproductspeci?cationsandallotherintellectualPropertyRightscreated.developedorprepared.documentedand/ordeliveredbyConsultant.pursuanttotheprovisionoftheServices.2.StatementsofWork.Duringthetennhereofandsubjecttothetemsandconditionscontainedherein.Consultantagreestoprovide.onanasrequestedbasis.theconsultingservices.systemsintegrationservices.dataconversionservices.trainingservices.andrelatedservices(the"Servlces')asfurtherdescribedinScheduleA(the“StatementofWork‘)forCity.andinsuchadditionalStatementsofWorkasmaybe1000EriglemondParkway.Englewood.Colorado80110-2373(303)762-2300www.engtewoodgov.orgrvs.un.:aitlixiiruwan...Brimuswim-Page 243 of 319 executedbyeachofthepartiesheretofromtimetotimepursuanttothisAgreement.EachStatementofWorkshallspecifythescopeofwork,speci?cations,basisofcompensationandpaymentschedule,estimatedlengthoftimerequiredtocompleteeachStatementofWork,includingtheestimatedstartl?nishdates,andotherrelevantinfomationandshallincorporatealltermsandconditionscontainedinthisAgreement3.PerfonnanceofServices.(a)Psrfomtance.ConsuitantshallperformtheServicesnecessarytocompleteallprojectsoutlinedinaStatementofWorkinatimelyandprofessionalmarinerconsistentwiththespeci?cations,ifany,setforthintheStatementofwork,andinaccordancewiththeprevailingengineeringstandardofcarebyexercisingtheskillandabilityordinarilyrequiredofengineersperformingthesameorsimilarservicesintheStateofColorado.consultantagreestoexerciseprofessionalism,andtoutilizeitse>¢ter1iseandcreativetalentsincompletingtheprojectsoutlinedinaStatementofWork.(I1)Delays.ConsultantagreestonotifyCitypromptlyofanyfactor,occurrence,oreventcomingtoitsattentionthatmayaffectConsultant'sabilitytomeettherequirementsoftheAgreement.orthatislikelytooccasionanymaterialdelayincompletionoftheprojectscontemplatedbythisAgreementoranyStatementofWork.Suchnoticeshallbegivenintheeventofanylossorreassignmentofkeyemployees,threatofstrike,ormajorequipmentfailure.TimeisexpresslymadeoftheessencewithrespecttoeachandeverytermandprovisionofthisAgreement.(clDiscrepancies.IfanythingnecessaryfortheclearunderstandingoftheServiceshasbeenomittedfromtheAgreementspeci?cationsoritappearsthatvenousinstructionsareincon?lct,ConsultantshallsecurewritteninstructionsfromCity'sprojectdirectorbeforeproceedingwiththeparton-nanceoftheServicesaffectedbysuchomissionsordiscrepancies.4.invoicesandPayment.UnlessotherwiseprovidedinaStatementofWork.CityshallpaytheamountsagreedtoinaStatementofWorkwithinthirty(30)daysfollowingtheacceptancebyCityoftheworkcalledforInaStatementofWorkbyCity.AcceptanceproceduresshallbeoutlinedintheStatementofWork.ifCitydisputesalloranyportionofaninvoiceforcharges,thenCityshallpaytheundisputedportionoftheinvoicebytheduedateandshallprovidethefollowingnotificationwithrespecttothedisputedportionoftheinvoice.CityshallnotifyConsultantassoonaspossibleofthespeci?camountdisputedandshallprovidereasonabledetailastothebasisforthedispute.ThepartiesshallthenattempttoresolvethedisputedportionofsuchInvoiceassoonaspossible.Uponresolutionofthedisputedportion,CityshallpaytoConsultanttheresolvedamount.5.Taxes.Cityisnotsubjecttotaxation.Nofederalorothertaxes(excise.luxury,transportation,sales,etc.)shallbeincludedinquotedprices.CityshallnotbeobligatedtopayorreimburseConsultantforanytaxesattributabletothesaleofanyServiceswhichareimposedonormeasuredbynetorgrossincome,capital,networth,franchise,privilege,anyothertaxes,orassessments.noranyoftheforegoingimposedonorpayablebyConsultant.Uponwrittennoti?cationbyCityandsubsequentveri?cationbyConsultant,Consultantshallreimburseorcredit,asapplicable,Cityinatimely‘manner.foranyandalltaxeserroneouslypaidbyCity.cityshallprovideConsultantwith,andConsultantshallacceptingoodfaith,resale,directpay.orotherexemptioncerti?cates,asapplicable.6.outofPocketExpenses.ConsultantshallbereimbursedonlyforexpenseswhichareexpresslyprovidedforinaStatementof1000EngiewoodParkway,Englewood.Colorado50110-2373(303)782-2300www.englewoodgav.orgmm'.-nwsuIranianDn-IIIurwirrrPage 244 of 319 WorkorwhichhavebeenapprovedinadvanceinwritingbyCity,providedConsultanthasfurnishedsuchdocumentationforauthorizedexpensesasCitymayreasonablyrequest.7.Audits.ConsultantshallprovidesuchemployeesandindependentauditorsandinspectorsasCitymaydesignatewithreasonableaccesstoallsitesfromwhichServicesareperformedforthepurposesofperformingauditsorinspectionsofConsultant'soperationsandcompliancewiththisAgreement.Consultantshallprovidesuchauditorsandinspectorsanyreasonableassistancethattheymayrequire.SuchauditsshallbeconductedinsuchawaysothattheServicesorservicestoanyothercustomerofConsultantarenotImpactedadversely.8.Tom:andTennlnatlon.ThetermofthisAgreementshallcommenceontheEffectiveDateandshallcontinueunlessthisAgreementisterminatedasprovidedinthisSection8.(a)Convenience.Citymay,withoutcauseandwithoutpenalty,terminatetheprovisionofServicesunderanyorallStatementsofWorkuponthirty(30)dayspriorwrittennotice.Uponsuchtermination,Cityshall.uponreceiptofaninvoicefromConsultant.payConsultantforServicesactuallyrenderedpriortotheeffectivedateofsuchtermination.ChargeswillbebasedontimeexpendedforallincompletetasksaslistedintheapplicableStatementofWork.andallcompletedtaskswillbechargedasindicatedintheapplicableStatementofWork.(hiNoOutstandingStatementsofWork.EitherpartymayterminatethisAgreementbyprovidingtheotherpartywithatleastthirty(30)dayspriorwrittennoticeofterminationiftherearenooutstandingStatementsofWork.(c)MaterialBreach.IfeitherpartymateriallydefaultsintheperformanceofanytermofaStatementofWorkorthisAgreementwithrespecttoaspecltlcStatementofWork(otherthanbynonpayment)anddoesnotsubstantiallycuresuchdefaultwithinthirty(30)daysafterrecah/ingwrittennoticeofsumdefault.thenthenon-defaultingpartymayterminatethisAgreementoranyoralloutstandingStatementsofWorkbyprovidingten(10)dayspriorwrittennoticeofterminationtothedefaultingparty.(d)Bankruptcyorinsolvency.EitherpartymayterminatethisAgreementeffectiveuponwrittennoticestatingitsintentiontoterminateintheeventtheotherparty:(1)makesageneralassignmentofallorsubstantiallyallofitsassetsforthebenefitofitscreditors;(2)appliesfor,consentsto,oracquiesoesintheappointmentofareceiver,trustee,custodian,orliquidatorforitsbusinessorallorsubstantiallyallofitsassets;(3)?les,orconsentstooracquiesoesin,apetitionseekingrelieforreorganizationunderanybankruptcyorinsolvencylaws;or(4)?lesapetitionseekingrelieforreorganizationunderanybankruptcyorinsolvencylawsistiledagainstthatotherpartyandisnotdismissedwithinsixty(60)daysafteritwas?ied.(e)TABOR.ThepartiesunderstandandacknowledgethateachpartyissubjecttoArticleX.§20oftheColoradoConstitution("TABOR").ThepartiesdonotintendtoviolatethetermsandrequirementsofTABORbytheexecutionofthisAgreement.ItIsunderstoodandagreedthatthisAgreementdoesnotcreateamulti-?scalyeardirectorindirectdebtorobligationwithinthemeaningofTABORand,notwithstandinganythinginthisAgreementtothecontrary.allpaymentobligationsofCityareexpresslydependentandconditioneduponthecontinuingavailabilityoffundsbeyondthetomofCity'scurrent?scalperiodendinguponthenextsucceedingDecember31.FinancialobligationsofCitypayableafterthecurrent?scalyeararecontingentuponfundsforthatpurposebeingappropriated,budgeted.andotherwisemadeavailableinaccordancewith1000EnglewoodParkway.Englewood.Colorado80110-2373(303)762-2300www.engIewoodgov.orgr-s.\Ir1qoV??iitci.,.m-..carp.iJE\il‘Vi'WPage 245 of 319 lherules,regulations,andresolutionsofCityandapplicablelaw.Uponthefailuretoappropriatesuchfunds,thisAgreementshallbedeemedtemilnated.(ftReturnofProperty.UponterminationofthisAgreement.bothpartiesagreetoreturntotheotherallproperty(includinganyCon?dentialinformation,asdefinedinSection11)oftheotherpartythatitmayhaveinitspossessionorcontrol.However,Consultantshallbeentitledtokeepone(1)copyofanysuchproperty,includingCon?dentialinformation,thatConsultantusedandrelieduponinundertakingtheservicesrequiredhereunder.9.CityObligations.Citywillprovidetimelyaccesstocitypersonnel,systemsandinformationrequiredforConsultanttoperformitsobligationshereunder,whichConsultantshallbeentitledtouseandrelyupon.CityshallprovidetoConsultantsemployeesperfom-lingitsobligationshereunderatCity’spremises,withoutcharge.areasonableworkenvironmentincompliancewithallapplicablelawsandregulations,Includingofficespace,fumlture,telephoneservice,andreprodudion,computer,famimile,secretarialandothernecessaryequipment,supplies,andservices.WithrespecttoallthirdpartyhardwareorsoftwareoperatedbyoronbehalfofCity,Cityshall,atnoexpensetoConsultant,obtainallconsents,licensesandsubliccnsesnecessaryforconsultanttoperfonnundertheStatementsofWorkandshallpayanyfeesorothercostsassociatedwithobtainingsuchconsents,licensesandsublicenses.10.Staff.ConsultantisanindependentconsultantandneitherConsultantnorConsultant'sstaffis.orshallbedeemedtobeemployedbyCity.CityisherebycontractingwithConsultantfortheServicesdescribedinaStatementofWorkandConsultantreservestherighttodetenniriethemethod,mannerandmeansbywhichtheServiceswillbeperiormed.TheServicesshallbeperformedbyConsultantorConsultant'sstaff,andCityshallnotberequiredtohire,superviseorpayanyassistantstohelpConsultantperfonntheServicesunderthisAgreement.ExcepttotheextentthatConsultant'sworkmustbeperformedonorwithCity’scomputersorcity'sexistingsoftware.allmaterialsusedInprovidingtheServicesshallbeprovidedbyConsultant.11.Confldentiallnformatlon.(a)Obligations.Eachpartyheretomayreceivefromtheotherpartyinformationwhichrelatestotheotherparty'sbusiness,research,development,tradesecretsorbusinessaffairs(‘Con?dentialInformation").SubjecttotheprovisionsandexceptionssetforthintheColoradoOpenRecordsAct,CRSSection24-72-101et.seq.,eachpartyshallprotectallCon?dentialInfonnationoftheotherpartywiththesamedegreeofcareasitusestoavoidunauthorizeduse,disclosure,publicationordisseminationofitsowncon?dentialinformationofasimilarnature,butinnoeventlessthanareasonabledegreeofcare.Withoutlimitingthegeneralityoftheforegoing,eachpartyheretoagreesnottodiscloseorpermitanyotherpersonorentityaccesstotheotherparty'sConfidentiallnfonnationexceptsuchdisclosureoraccessshallbepermittedtoanemployee,agent,representativeorindependentconsultantofsuchpartyrequiringaccesstothesameinordertoperfom-Ihisorheremploymentorservices.Eachpartyshallinsurethattheiremployees,agents,representatives,andindependentconsultantsareadvisedofthecon?dentialnatureoftheCon?dentialinformationandareprecludedfromtakinganyactionprohibitedunderthisSection11.Further,eachpartyagreesnottoalterorremoveanyidenti?cation.copyrightorotherproprietaryrightsnoticewhichIndicatestheownershipofanypartofsuchCon?dentialInformationbytheotherprty.Apartyheretoshallundertaketoimmediatelynotifytheotherpartyinwritingofiicircumstances1000EnglewoodFentway,Englewood,Colorado30110-2373(303)762-2300www.englewoodgov.nrgPSA/I7-isPipcilnolnprlkinnaigiiusmm-Page 246 of 319 surroundinganypossession,useorknowledgeofCon?dentialinformationatanylocationorbyanypersonorentityotherthanthoseauthorizedbythisAgreement.Notwithstandingtheforegoing,nothinginthisAgreementshallrestricteitherpartywithrespecttoinformationordataidenticalorsimilartothatcontainedintheCon?dentialinformationoftheotherpartybutwhich(1)thatpartyrightfullypossessedbeforeItreceivedsuchinformationfromtheotherasevidencedbywrittendocumentation;(2)subsequentlybecomespubliclyavailablethroughnofaultofthatparty;(3)issubsequentlyfumiahedrightfullytothatpartybyathirdpartywithoutrestrictionsonuseordisclosure;or(4)isrequiredtobedisclosedbylaw,providedthatthedisclosingpartywillexercisereasonableeffortstonotifytheotherpartypriortodisclosure.(b)Know-How.FortheavoidanceofdoubtneitherCitynorConsultantshallbepreventedfrommakinguseofknow-howandprinciplesieamedorexperiencegainedofanon-proprietaryandnon-con?dentialnature.(c)Remedies.Eachofthepartiesheretoagreethatifanyofthem,theirof?cers,employeesoranyoneobtainingaccesstotheCon?dentiallnforrnationoftheotherpartyby,throughorunderthem.breachesanyprovisionofthisSection11.thenon-breachingpartyshallbeentitledtoanaccountingandrepaymentofallpro?ts,compensation.commissions,remunerationsandbenefitswhichthebreachingparty.itsof?cersoremployeesdirectlyorindirectlyrealizeormayrealizeasaresultoforgrowingoutof,orinconnectionwithanysuchbreach.Inadditionto,andnotinlimitationoftheforegoing,intheeventofanybreachofthisSection11,thepartiesagreethatthenon-breachingpartywillsufferirreparableharmandthatthetotalamountofmonetarydamagesforanysuchinjurytothenon—breachingpartyarisingfromaviolationofthisSet-Alon11wouldbeimpossibletocalculateandwouldthereforebeaninadequateremedyatlaw.Accordingly.thepartiesagreethatthenon-breachingpartyshallbeentitledtotemporaryandpermanentinjunctivereliefagainstthebreachingparty.itsofficersoremployeesandsuchotherrightsandremediestowhichthenon-breachingpartymaybeentitledtoatlaw,inequityorunderthisAgreementforanyviolationofthisSection11.TheprovisionsofthisSection11shallsurvivetheexpirationorterminationofthisAgreementforanyreason.12.ProjectManagers.EachpartyshalldesignateoneofitsemployeestobeitsProjectManagerundereachStatementofWork,whoshallactforthatpartyonallmattersundertheStatementofWork.EachpartyshallnotifytheotherInwritingofanyreplacementofaProjectManager.TheProjectManagersforeachStatementofWorkshallmeetasoftenaseitheronerequeststoreviewthestatusoftheStatementofWork.13.Warranties.(a)Authority.Consultantrepresentsandwarrantsthat:(1)Consultanthasthefullcorporateright,powerandauthoritytoenterintothisAgreementandtoperformtheactsrequiredofithereunder;(2)theexecutionofthisAgreementbyConsultant.andthepertcrmanoebyConsultantofitsobligationsanddutieshereunder,donotandwillnotviolateanyagreementtowhichConsultantisapartyorbywhichitisotherwiseboundunderanyapplicablelaw,mieorregulation;(3)whenexecutedanddeliveredbyConsultant.thisAgreementwillconstitutethelegal.validandbindingobligationofsuchparty,enforceableagainstsuchpartyinaccordancewithitsterms;and(4)ConsultantacknowledgesthatCitymakesnorepresentations,warrantiesoragreementsrelatedtothesubjectmatterhereofthatarenotexpresslyprovidedforinthisAgreement(b)serviceWarranty.Consultantwarrantsthatitsemployeesandconsultants1000EnglewoodParkway.Englewood.Colorado50110-2373(303)762-2300www.engIewoodgov.crgi’§Itfl7-ElrhpslineIlll?iltlllraw‘...LIE\V\\'n'Page 247 of 319 shallhavesuf?clentskill,knowledge.andtrainingtoperformServicesandthattheServicesshallbeperformedinaccordancewiththestandardofcaredelineatedinSection3(a).(c)Personnel.Unlessaspeci?cnumberofemployeesissetforthIntheStatementofWork.Consultantwillprovidesuf?cientemployeestocompletetheServicesorderedwithintheapplicabletimeframesestablishedpursuanttothisAgreementorassetforthintheStatementofWork.DuringthecourseofperformanceofServices.Citymay.foranyornoreason.requestreplacementofanemployeeoraproposedemployee.Insuchevent‘.Consultantshall.within?ve(5)workingdaysofreceiptofsuchrequestfromCity,provideasubstituteemployeeofsufficientskill.knowledge.andtrainingtoperfonntheapplicableServices.ConsultantshallrequireemployeesprovidingServicesataCitylocationtocomplywithapplicableCitysecurityandsafetyregulationsandpolicies.(d)CompensationandBene?ts.Consultantshallprovideforandpaythecompensationofemployeesandshallpayalltaxes.contributions.andbene?ts(suchas.butnotlimitedto,workers’compensationbene?ts)whichanemployerisrequiredtopayrelatingtotheemploymentofemployees.CityshallnotbeliabletoconsultantortoanyemployeeforConsultant'sfailuretoperfonnitscompensation.benefit.ortaxobligations.Consultantshallindemnify,defendandholdCityharmlessfromandagainstallsuchtaxes.contributionsandbene?tsandwillcomplywithallassociatedgovernmentalregulations.includingthe?lingofallnecessaryreportsandreturns.14.indemni?cation.(a)ConsultantIndemni?cation.consultantshallindemnify.defendandholdharmlessCity.itsdirectors.of?oers.employees.andagentsandtheheirs.executors.successors,andpermittedassignsofanyoftheforegoing(the“Cityindemnltaes")fromandagainstalllosses.claims,obligations.demands.assessments,?nesandpenalties(whethercivilorcriminal).liabilities,expensesandcosts(includingreasonablefeesanddisbursementsoflegalcounselandaccountants).bodilyandotherpersonalInjuries,damagetotangibleproperty,andotherdamages.ofanykindornature.sufferedorIncurredbyaCitylndemnlteetotheextentcausedby2(1)anynegligentactoromissionbyConsultantoritsrepresentativesintheperformanceofConsultant'sobligationsunderthisAgreement.or(2)anymaterialbreachinarepresentation.warranty.covenantorobligationofConsultantcontainedinthisAgreement.Notwithstandingtheforegoing.intheeventthesubjectactionallegesnegligenceonthepartofConsultantand/or'Clty.oranythirdpartynotundercontractwithconsultant.consultant'sobligationsregardingCity'sdefenseunderthisparagraphincludeonlythereimbursementoftheCity'sreasonabledefensecostsincurredtotheextendodconsultant’:negligenceasexpresslydeterminedbya?naljudgment.arbitration.award.order,settlement,orother?nalresolution.Consultantshallnotberesponsibleforbreachof?duciaryduty,lossofanticipatedpro?tsorforeconomic,incidentalorconsequentialdamagestoCityoranythirdpartyarisingoutofbreachofcontract.termination.orforanyotherreasonwhatsoever.Additionally.Consultantshallnotberesponsibleforactsanddecisionsofthirdparties.includinggovernmentalagencies.otherthanConsultant'ssubconsultants.thatImpactprojectcompletionandlorsuccess(In)infringementConsultantwillindemnify.defend.andholdCityharmlessfromallIndemni?ableLossesrisingfromanythirdpartyclaimsthatanyWorkProductormethodologysuppliedbyconsultantinfringesormisappropriatesanyIntellectualPropertyrightsofanythirdparty:provided.however.thattheforegoingindemni?cationobligation1000EnglewoodParkway.Englewood.Colorado80110-2373(303)762-2300www.engIewoodgov.orgPXA/I7~E?Ii4?llE|lI)'!?ilIon"...u:wtvrrPage 248 of 319 shallnotapplytoanyallegedInfringementormisappropriationbasedon:(1)useoftheWorkProductincombinationwithproductsorservicesnotprovidedbyConsultanttotheextentthatsuchInfringementormisappropriationwouldhavebeenavoidedifsuchotherproductsorserviceshadnotbeenused;(2)anymodi?cationorenhancementtotheWorkProductmadebyCityoranyoneotherthanConsultantoritssub-consultants:or(3)useoftheWorkProductotherthanaspennitiedunderthisAgreement.(c)Indemni?cationProcedures.Notwith-standinganythingelsecontainedinthisAgreement.noobligationtoindemnifywhichissetforthInthisSection14shallapplyunlessthepartyclaimingindemni?cationnotifiestheotherpartyassoonaspracticabletoavoidanyprejudiceintheclaim,suitorproceedingofanymattersinrespectofwhichtheindemnitymayapplyandofwhichthenotifyingpartyhasknowledgeandgivestheotherpartytheopportunitytocontroltheresponsetheretoandthedefensethereof;provided,however,thatthepartyclaimingindemni?cationshallhavetherighttoparticipateinanylegalproceedingstocontestanddefendaclaimforindemni?cationinvolvingathirdpartyandtoberepresentedbyitsownattorneys.allatsuchparty'scostandexpense;providedfurther.however,thatnosettlementorcompromiseofanassertedthird-partyclaimotherthanthepaymentlmonaymaybemadewithoutthepriorwrittenconsentofthepartyclaimingindemni?cation.(d)Immunity.City.itsof?cers,anditsemployees,arerelyingon,anddonotwaiveorintendtowaivebyanyprovisionofthisAgreement,themonetarylimitationsoranyotherrights,Immunities,andprotectionsprovidedbytheColoradoGovemmentaiimmunityAct,C.R.S.24-10-101etseq..asfromtimetotimeamended,orotherwiseavailabletoCity.itsofticers,oritsemployees.15.insurance.(a)Requirements.ConsultantagreestokeepinfullforceandeffectandmaintainatitssolecostandexpensethefollowingpoliciesofinsuranceduringthetermofthisAgreement:(1)TheConsultantshallcomplywiththeWorkers‘CompensationActofColoradoandshallprovidecompensationinsurancetoprotecttheCityfromandagainstanyandallWorkers’Compensationclaimsarisingfromperformanceoftheworkunderthiscontract.Workers’Compensationinsurancemustcoverobligationsimposedbyapplicablelawsforanyemployeeengagedintheperformanceofworkunderthiscontract.aswellastheEmployers‘Liabilitywithintheminimumstatutorylimits.(2)CommercialGeneralLiabilityinsuranceandautoliabilityinsurance(includingcontractualliabilityinsurance)providingcoverageforbodilyInjuryandpropertydamagewithacombinedsinglelimitofnotlessthanthreemilliondollars($3,000,000)peroccurrence.(:1)ProfessionalLiability/ErrorsandOmissionsInsurancecoveringacts,errorsandomissionsarisingoutofConsultant'soperationsorServicesinanamountnotlessthanonemilliondollars($1,000,000)peroccurrence.(4)EmployeeDishonestyandComputerFraudinsuranceoovertnglossesarisingoutoforinconnectionwithanyfraudulentordishonestactscommittedbyConsultantpersonnel,actingaloneorwithothers,Inanamountnotlessthanonemilliondollars($1,000,000)peroocurrenoe.(b)ApprovedCompanies.Allsuchinsuranceshallbeprocuredwithsuchinsurancecompaniesofgoodstanding.pennlttedtodobusinessinthecountry,stateorterritorywheretheServicesarebeingperformed.1000EnglewoodParkway.Englewood,Colorado50110-2373(303)762-2300www.engiewoodgov.orgr>sAIi'I2t:Pipdil:r..5=ar..Duiyruzwim-Page 249 of 319 (c)Certi?cates.ConsultantshallprovideCitywithcerti?catesofinsuranceevidencingcompliancewiththisSection15(includingevidenceofrenewalofinsurance)signedbyauthorizedrepresentativesoftherespectivecarriersforeachyearthatthisAgreementisineffect.Certi?catesofinsurancewilllisttheCityofEnglewoodasanadditionalinsured,exceptastoWorker'sCompensationandProfessionalLiabi|ityIEnorsandOmissionsinsurance.Eachcerti?cateofinsuranceshallprovidethattheissuingcompanyshallnotcancelorreduce,theinsuranceaffordedundertheabovepoliciesunlessthirty(30)days‘noticeofsuchcancellationorreductionhasbeenprovidedtoCity.16.RightsinWorkProduct.(a)Generally.Exceptasspeci?callyagreedtothecontraryInanyStatementofWork,allintellectualPropertyRightsinandtotheWorkProductproducedorprovidedbyConsultantunderanyStatementofWorkshallremainthepropertyofConsultantWithrespecttotheWorkProduct,ConsultantunconditionallyandirrevocablygrantstoCityduringthetermofsuchintellectualPropertyRights,anon-exclusive,irrevocable,perpetual.worldwide,fullypaidandroyalty-freelicense,toreproduce,createderivativeworksof,distribute,publiclyperfonnandpubliclydisplaybyallmeansnowknownorlaterdeveloped,suchintellectualPropertyRights.(b)Know-How.Notwithstandinganythingtothecontraryherein.eachpartyanditsrespectivepersonnelandconsultantsshallbefreetouseandemployitsandtheirgeneralskills,know-how,andexpertise.andtouse,disclose,andemployanygeneralizedideas.concepts,know-how.methods,techniques,orskillsgainedorlearnedduringthecourseofanyassignment.solongasItortheyacquireandapplysuchinformationwithoutdisclosureofanyCon?dentiallnfomtationoftheotherparty.17.RelationshipofParties.Consultantisactingonlyasanindependentconsultantanddoesnotundertake.bythisAgreement,anyStatementofWorkorotherwise,toperfonnanyobligationofCity,whetherregulatoryorcontractual,ortoassumeanyresponsibilityforCity’sbusinessoroperations.Neitherpartyshallactorrepresentitself,directlyorbyimplication,asanagentoftheother,exceptasexpresslyauthorizedinaStatementofWorlc18.CompleteAgreement.ThisAgreementcontainstheentireagreementbetweenthepartiesheretowithrespecttothematterscoveredherein.19.ApplicableLaw.Consultantshallcomplywithallapplicablelawsinperfon-ningServicesbutshallbeheldhannlessforviolationofanygcvemmentalprocurementregulationtowhichitmaybesubjectbuttowhichreferenceisnotmadeintheapplicableStatementofWork.ThisAgreementshallbeconstruedinaccordancewiththelawsoftheStateofColorado.AnyactionorproceedingbroughttointerpretorenforcetheprovisionsofthisAgreementshallbebroughtbeforethestateorfederalcourtsituatedInArapahoecounty.Coloradoandeachpartyheretoconsentstojurisdictionandvenuebeforesuchcourts.20.ScopeofAgreement.IfthescopeofanyprovisionsofthisAgreementistoobroadinanyrespectwhatsoevertopennltenforcementtoitsfullestextent,thansuchprovisionshallbeenforcedtothemaximumextentpen-nittedbylaw,andthepartiesheretoconsenttoandagreethatsuchscopemaybejudiciallymodi?edaccordinglyandthatthewholeofsuchprovisionofthisAgreementshallnottherebyfail,butthatthescopeofsuchprovisionshallbecurtailedonlytotheextentnecessarytoconfonntolaw,21.AdditionalWork.AfterreceiptofaStatementofWork,City.withConsultant'sconsent,mayrequestConsultanttoundertake1000EngiewoodParkway,Englewood.Coloradoao11t>2373(303)762-2300www.englewoodgcv.orgmlII7-:6fluxlineluinutrmDulwluewwrrPage 250 of 319 additionalworkwithrespecttosuchStatementofWork.Insuchevent.CityandConsultantshallexecuteanaddendumtotheStatementofWorkspecifyingsuchadditionalworkandthecompensationtobepaidtoConsultantforsuchadditionalwork.22.Sub-consultants.ConsultantmaynotsubcontractanyoftheServicestobeprovidedhereunderwithoutthepriorwrittenconsentofCity.Intheeventofanypermittedsubcontracting,theagreementwithsuchthirdpartyshallprovidethat.withrespecttothesubcontractedwork,suchsuh~consultantshallbesubjecttoalloftheobligationsofConsultantspeci?edinthisAgreement.2:.Notices.AnynoticeprovidedpursuanttothisAgreementshallbeInwritingtothepartiesattheaddressessetforthbelowandshallbedeemedgiven(1)ifbyhanddelivery,uponreceiptthereof,(2)three(3)daysafterdepositintheUnitedStatesmails,postageprepaid,certifiedmail,returnreceiptrequestedor(3)one(1)dayafterdepositwithanationally-recognized~cvemightcourier,specifyingovemlghtprioritydelivery.EitherpartymaychangeitsaddressforpurposesofthisAgreementatanytimebygivingwrittennoticeofsuchchangetotheotherpartyhereto.24.Assignment.ThisAgreementmaynotbeassignedbyConsultantwithoutthepriorwrittenconsentofCity.Exceptfortheprohibitionofanassignmentcontainedintheprecedingsentence,thisAgreementshallbebindinguponandinuretothebene?toftheheirs,successorsandassignsofthepartieshereto.25.ThirdPartyBene?ciaries.ThisAgreementisenteredintosolelyforthebene?tofthepartiesheretoandshallnotconferanyrightsuponanypersonorentitynotapartytothisAgreement.NopersonorentitynotasignatorytothisAgreementshallbeentitledtorelyonConsultant'sperformanceofitsserviceshereunder,andnorighttoassertaclaimagainstConsultantbyassignmentofindemnityrightsorothenwiseshallaccruetoathirdpartyasaresultoithisAgreementortheperformanceofConsultant'sserviceshereunder.26.Headings.ThesectionheadingsinthisAreementaresolelyforconvenienceandshallnotbeconsideredinitsInterpretation.Therecitalssetforthonthe?rstpageofthisAgreementareincorporatedintothebodyofthisAgreement.TheexhibitsreferredtothroughoutthisAgreementandanyStatementofWorkpreparedInconformancewiththisAgreementareIncorporatedintothisAgreement.27.Waiver.ThefailureofeitherpartyatanytimetorequireperfonnencebytheotherpartyofanyprovisionofthisAgreementshallnoteffectinanywaythefullrighttorequiresuchperionnanceatanysubsequenttime:norshallthewaiverbyeitherpartyofabreachofanyprovisionofthisAgreementbetakenorheldtobeawaiveroftheprovisionitself.2!).ForceMajeure.ifperformancebyconsultantofanyserviceorobligationunderthisAgreementisprevented,restricted,delayedorinterferedwithbyreasonoflabordisputes,strikes,actsofGod,?oods,lightning,severeweather,shortagesofmaterials,rationing.utilityorcommunicationsfailures,earthquakes.war,revolution,civilcommotion,actsofpublicenemies,blockade,embargooranylaw.order.proclamation,regulation.ordinance,demandorrequirementhavinglegalefiectofanygovernmentalorJudicialauthorityorrepresentativeofanysuchgovernment.oranyotheractwhethersimilarordissimilartothosereferredtointhisclause,whicharebeyondthereasonablecontrolofConsultant,thenConsultantshallbeexcusedfromsuchperformancetotheextentofsuchprevention,restriction,delayorinterference.Iftheperiodofsuchdelayexceedsthirty(30)days.Citymay.withoutliability.tenninatethe1000EngiewoodParkway,Englewcod.Colorado50110-2373(303)762-2300www.eng|ewoodguv.crgM/n.~.i.Prelim:i..,=mn..onlyin;mm-Page 251 of 319 affectedStatementofWork(s)uponwrittennoticetoConsultant.29.TimeofPerformance.TimeisexpresslymadeoftheessencewithrespecttoeachandeverytermandprovisionofthisAgreement.30.Permits.Consultantshallatitsownexpensesecureanyandalllicenses.permitsorcertificatesthatmayberequiredbyanyfederal.stateorlocalstatute.ordinanceorregulationfortheperformanceoftheServicesundertheAgreement.ConsultantshallalsocomplywiththeprovisionsofallApplicableLawsinperfonningtheServicesundertheAgreement.AtitsownexpenseandatnocosttoCity.Consultantshallmakeanychange.alterationormodi?cationthatmaybenecessarytocomplywithanyApplicableLawsthatConsultantfailedtocomplywithatthetimeofperforrnanoeoftheServices.31.MediaReleases.ExceptforanyannouncementintendedsolelyforintemaidistributionbyConsultantoranydisclosurerequiredbylegal.accounting.orregulatoryrequirementsbeyondthereasonablecontrolofConsultant,allmediareleases.publicannouncements.orpublicdisclosures(including.butnotlimitedto,promotionalormarketingmaterial)byConsultantoritsemployeesoragentsrelatingtothisAgreementoritssubjectmatter,orincludingthename,trademark.orsymbolofCity.shallbecoordinatedwithandapprovedinwritingbyCitypriortothereleasethereof.ConsultantshallnotrepresentdirectlyorIndirectlythatanyServicesprovidedbyConsultanttoCityhasbeenapprovedorendorsedbyCityorincludethename.trademark.orsymbolofCityonalistofConsultant'scustomerswithoutcity'sexpresswrittenconsent.32.NonexciuslveMarketandPurchaseRights.ItisexpresslyunderstoodandagreedthatthisAgreementdoesnotgranttoConsultantanexclusiverighttoprovidetoCityanyoralloftheServicesandshallnotpreventCityfromacquiringfrontothersupplier'sservicessimilartotheServices.ConsultantagreesthatacquisitionsbycitypursuanttothisAgreementshallneitherrestricttherightofCitytoceaseacquiringnorrequireCitytocontinueanylevelofsuchacquisitions.EstimatesorforecastsfurnishedbyCitytoConsultantpriortoorduringthetermofthisAgreementshallnotconstitutecommitments.33.Survival.TheprovisionsofSections5,B(g).10.11.13.14.1B.17.19.23.25and31shallsunilveanyexpirationortenninationforanyreasonofthisAgreement.34.VerificationofCompliancewithC.R.S.B-17.5-101ET.SEQ.RegardingHiringofIllegalAliens:(a)Employees.ConsultantsandSub-consultants:ConsultantshallnotknowinglyemployorcontractwithanillegalalientoperformworkunderthisContract.Consultantshallnotcontractwithasub-consultantthatfailstocertifytotheConsultantthatthesub—consultantwillnotknowinglyemployorcontmctwithanillegalalientoperfonnworkunderthisContract.[CR88-17.5-102(2)(a)(|)&(lI).](b)Veri?cation:ConsultantwillparticipateineithertheE-VerityprogramortheDepartmentprogram,asde?nedinC.R.S.B-17.5-101(3.3)and8-17.5-101(3.7),respectively,inordertocontinntheemploymenteligibilityofallemployeeswhoarenewlyhiredforemploymenttoperformworkunderthispubliccontractforservices.ConsultantisprohibitedfromusingtheE-VerifyprogramortheDepartmentprogramprocedurestourlcieriakepre-employmentscreeningofjobapplicantswhilethiscontractisbeingperformed.(c)DutytoTerminateaSubcontract:itConsultantobtainsactualknowledgethatasub-consultantperformingI000EngiewoodParkway.Engiewood.Colorado80110-2373(303)762-2300www.englewoodgov.orgDEA/If-:5want:llils?illonly.uswwrvPage 252 of 319 workunderthisContractknowinglyemploysorcontractswithanillegalalien,theConsultantshall;(1)notifythesub-consultantandtheCitywithinthreedaysthattheconsultanthasactualknowledgethatthesub-consultantisemployingorcontractingwithanillegalalien;and(2)terminatethesubcontractwiththesub-consultantif,withinthreedaysofreceivingnoticerequiredpursuanttothisparagraphthesub-consultantdoesnotstopemployingorcontractingwiththeillegalalien;exceptthattheConsultantshallnottenninatethecontractwiththesub-oonsultantIfduringsuchthreedaysthesub-consultantprovidesinformationtoestablishthatthesub-consultanthasnotknowinglyemployedorcontractedwithanillegalalien.(d)DutytocomplywithStateInvestigation:ConsultantshallcomplywithanyreasonablerequestoftheColoradoDepartmentofLaborandEmploymentmadeinthecourseofanInvestigationbythattheDepartmentisundertakingpursuanttoC,R.S.8-17.5-102(5)(e)DamagesforBreachofContract:TheCitymayterminatethiscontractforabreachofoontract,inwholeorInpart,duetoConsultant'sbreachofanysectionofthisparagraphorprovisionsrequiredpursuanttoCR56-17.5-102.ConsultantshallbeliableforactualandconsequentialdamagestotheCityInadditiontoanyotherlegalorequitableremedytheCitymaybeentitledtoforabreachofthiscontractunderthisParagraph34.it)EstimatesandProjections:Inprovidingoptionsofcost,?nancialanalyses,economicfeasibilityprojections,and-schedulesforpotentialprotects.Consultanthasnocontrolovercostorpriceoflaborandmaterial;unknownorlatentconditionsofexistingequipmentorstructuresthatmyaffectoperationandmaintenancecosts;competitivebiddingproceduresandmarketconditions;timeorqualityofperion-nanceofthirdparties;quality.type.management,ordirectionofoperatingmanagement,ordirectionofoperatingpersonnel;andothereconomicandoperationalfactorsthatmaymateriallyaffecttheultimateprojectorschedule.Therefore,ConsultantmakesnowarrantythattheCity'sactualprojectcosts.?nancialaspects,economicfeasibility,orscheduleswillnotvaryfromConsultants‘opinions,analyses,projections,orestimates.1DODEnglewoodParkway.Englewood.Colorado50110-2373(303)732-2300www.englewoodgov.orgi‘\A/I7-1»Pipelineih}r¢1mnDe¢I3i|llEivu-rrPage 253 of 319 INWITNESSWHEREOF.thepartiestothisAgreementhavecausedittobeexecutedbytheirauthorizedof?cersasofthedayandyear?rstabovewritten,ThisAgreementmaybeexecutedincounterparts.eachofwhichshallbedeemedanoriginal‘butallofwhichtogethershallconstituteoneandthesameinstrument.CITYOFENGLEWOOD,COLORADOBy:Date:(DoplrtmuntDlractor)By:Date:(cltymlnager)By:Date:(Mayor)A'|'|'EST:CityClerkEn-(ConsultantName)SE50Lfgtoc?Crul-._a£iSEKODA?drnscl.CO87,Olly,Shto,Zlpdo(slunlluru){FIIIIINllvll)Tltle:rutRE11000EnglewoodParkway,Englewuud.Colorado801104373(303)762-2300www.eng|ewoodgov.org1-s/.m.2spl;-1r.m.r;...:e.lDawnusmmPage 254 of 319 SCHEDULEAOUTLINEOFSTATEMENTOFWORK1.GENERALThisScheduleisattachedtoandmadeapartattheProfessionalServicesAgreementdatedv51’I,2017,betweentheCityofEnglewood(CITY)andCarolloEngineers,Inc(CONSULTANT)forprofessionalservicesforthePipelineInjectionDesignProject.2.NAMESOFPROJECTCOORDINATORSTheCity'sProjectManagerwillbeGunterRitler,P.E.TheConsultant‘:ProjectManagerwillbeBeckyLuna.P.E.3.SUMMARYOFPURPOSEFORSTATEMENTOFWORKTheConsultantwillprovidepreliminaryand?naldesignengineeringservicesforabiogaspipelineinjectionfacilityattheLittietonEngiewoodWastewaterTreatmentPlant(LEWWTP).4.EQUIPMENTANDPROGRAMMINGTOBEPROVIDEDBYCITY(IFANY)TheCITYwillprovidedataandinformationrequestedbytheCONSULTANT,itavailable.5,OTHERCONSULTANTRESOURCESTheCONSULTANTwillprovidethemanagementandtechnicalexpertisetocompletethescopeofworkdescribedbelow.Theseindividualsconsistofthefollowingbutarenotlimitedto;projectmanagement,technicalexpertsinblo—gasproductionandbene?cialre-use.6.DESCRIPTIONOFWORKPRODUCTANDDELIVERABLESTheCONSULTANT’sscopeofworkincludesthefollowingtasksanddeliverables.Task1-ProjectManagementTask1.1-ProjectManagementandAdministrationCONSULTANTshallprovideprojectmanagementservices.whichincludethefollowingtasks:-Preparemonthlyprogressreports.-Maintainandmonitorprojectscope,budget.andschedule.-Provideadministrativeguidanceandsupervisionofstaff,includingprojectplanning.1000EnglewoodParkway,Englewood.Colorado80110-2373(SE3)762-zaonwww.angIewoodgov.orgrssmmheath:lnminnml."uswwnvPage 255 of 319 Task1.2—ProjectInitiationandKickoffMeetingCONSULTANTshallprepareadocumentforintemalcommunicationsummarizingprojectscope.projectresponsibilitiesandcontacts,projectresourcesandcommunicationplan,projectstaffingplan,andprojectbudget.CONSULTANTshallcoordinateinternalprojectkickoffmeetingTheCONSULTANTwillcoordinateandattendaprojectkickoiimeetingtoreviewthescopeofworkanddevelopandde?netheClTY'sgoalsandobjectivesfortheproject.Thekickoffmeetingwillbrie?yreviewapreliminarylayoutforthegasconditioningskidandpipelinetoconnecttotheexistingXcelpipeline.Task2—PreliminaryDesignSubtask2.1—PreliminaryAnalysisandLayoutCONSULTANTshalldevelopuptotwo(2)locationsforthebiogasconditioningsystemandthemialoxidizing?are.CONSULTANTshalldevelopuptotwo(2)routingsforthebiogaspipelinebetweenthebiogasconditioningsystemandtheXcelmeteringandmonitoringequipment.PreliminarylayoutswillbereviewedwiththeCITYduringthekickoffmeeting.Subtask2.2-ElectricalLoadStudyCONSULTANTshallreviewexistingelectricaldrawingstocon?rmthereissufticientinfrastructureavailablefortheadditionalelectricalloadsrequiredbythebiogasconditioningsystem,thermaloxidizing?are,ndXcelEnergymeteringandmonitoringequipment.Subtask2.3—PennmingAssistanceandSupportCONSULTANTwillprovidethebuildingdepartmentand?remarshalwithcontractdocumentsasrequiredtoragencyreview.CONSULTANTwillrespondtoquestionsasneededtocoordinatereviewandapprovaloftheproject.Subtask2.4—TechnicalSupportforXcelEnergyandBrokerContractsTheCITYwilltaketheleadondevelopmentofcontractsbetweentheL/EVVlNTPandXcelEnergyandthecarbonbroker,respectively.CONSULTANTshallprovidetechnicalsupportforcontractdevelopment,includingcontractreviewanddiscussionswithXcelEnergyandthecarbonbrokers.Subtask2.5—CoordinationwithXcelEnergyforMeteringandMonitoringEquipmentCONSULTANTshallcoordinatewithXcelEnergytodeterminethelimitsofdesignofthesystem.XcelEnergyshalldesignandconstructthebiogesmeteringandmonitoringequipmentandconnectiontotheXcelEnergypipelinethatrunsalongthenorthernboundaryoftheLIEV\MiTP.CONSULTANTwillprovidepowerasneededtothebiogasmeteringandmonitoringequipmentprovidedbyXcel.CONSULTANTshallattenduptoone(1)meetingwithXceltodiscusscoordinationitems.Subtask2.6—ConditioningSystemProcurement1000EnglewoodParkway.Englewood,Colorado80110-2373(303)762-2300www,englewoodgov.argi‘L\m-anfivtliuclrlisnimioer,-nLIEwvzrrPage 256 of 319 CONSULTANTshalipreparedrawingsandspeci?cationsforearlyprocurementofthebiogasconditioningequipment.includingthethennsloxid'zing?are.Procurementofthebiogasconditioningequipmentwilluseabestvalueselectionprocess.CONSULTANTshallassistCITYindevelopingevaluationcriteriafortheRequestforProposals(RFP)issuedtoequipmentmanufacturers.CONSULTANTshallreviewproposalssubmittedbymanufacturersandassistCITYinperformingbest-valueevaluation.Selectioncriteriasuchasservicerecord,equipmentwarrantiesandperformance,maintenancerequirements.andreferenceinstallationswillbereviewedIndetail.Subtask2.7-PreliminaryDesignDrawingsCONSULTANTshallpreparepreliminarydesigndrawingson22"x34'sheetsize(11'x17'halt-size)inMicrostationv8XM.Preliminarydesigndrawingswillconveybasicprojectelementstoa30percentdesigncompletion,includingbiogasconditioningsystem.thermaloxidizing?are.andconnectionofbiogasconditioningsystemtoexistingbiogassystemandXcelmeteringandmonitoringequipment.Subtask2.8-PreliminaryDesignCostEstimateCONSULTANTshallprepareanestimateofthecostoftheworkbasedonthepreliminarydesigndrawings.CostestimateswillbedevelopedtotheClass4levelperthestandardsoftheAssociationfortheAdvancementofCostEngineering(AACE).CostestimatewillbefurnishedtoCITYapproximatelytwoweeksfollowingthepreliminarydesigndrawingsubmittal.Subtask2.9—PreliminaryDesignWorkshopCONSULTANTshallprepareforandattendapreliminarydesignworkshoptoreviewthepreliminarydesigndrawingsandconcepts.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.Task3—FinalDesignsubtask3.1—DrawingsCONSULTANTshallpreparedrawingson22'x34"sheetsize(11"x17'half-size)inMicrostationV8XM.AlistofanticipateddrawingsrequiredforadequaterepresentationoftheprojectelementsisincludedInAttachmentA.CONSULTANTwillsubmitprogresssubmittaidrawingsandspeci?cationsat60percentand90percentforCITYreview.Designelementsincludedintheprojectareasfollows:-Pipelinetoconnectexistingblogassysteminsidedigestioncomplextoblogasconditioningsystem.-Biogasconditioningsystemlocatedadjacenttoexistingdigestioncomplexonslabongradefoundation.-Thermaloxidizing?are.-Pipelinetoconnectblogasconditioningsystemtometeringndmonitoringequipment(designedandconstructedbyXcelEnergy).1000ErtglcwoodParkway.Englawood.Colorado30110-2373(303)762-2300www.engiewoodgcv.orgi'.$i\li7-1rJi|:eilIIcInjectionDuiguusmm-Page 257 of 319 Subtask3.2—Specl?catlonsProjectspecificationsshallbepreparedusingClTY'sDivision00documentsandCONSULTANT'sDivision01documentsandtechnicalspeolllcationsusingthecurrentMasterForn1at(Div48).Subtask3.3-ProgressSubmittalsCONSULTANTwillsubmitprogresssubrnittaldrawingsandspeci?cationsat60percentand90percentforCITYreview.TheCITYwillreviewprogresssubmittals,compileallreviewcommentsintoonesetofcoordinateddocuments,andsubmitcommentstotheCONSULTANTwithinfourteen(14)daysafterreceiptofdocumentpackagesubmittal.Subtask3.4-CostEstimateCONSULTANTshallprepareanestimateofthecostoftheworkbasedonthe60percentand90percentDrawingsandSpecifications.CostestimateswillbedevelopedtotheClass3and2level,respectively.perthestandardsoftheAACE.CostestimateswillbefurnishedtoClTYapproximatelytwoweeksfollowingeachprogresssubmlttal.Task3.5-DsslgnWorkshopsCONSULTANTshallprepareforandattend60percentand90percentdesignworkshopstoreviewprogresssubmittals.CONSULTANTwillcompilemeetingnotesandsubmittoCITYwithinseven(7)daysaftermeeting.Task3.6—ConstructionSequencingCONSULTANTshalldevelopabaselineconstmctionsequencingplaninMicrosoftProjectthatindicatesrequirementsforsequencingstartupofnewprocessesandtakingexistingprocesselementsoutofserviceduringconstruction.Theconstructionsequencingplanwilltakeintoaccountearlyprocurementofthebiogasconditioningsystemand.ifdesired.earlycontractorselection.Thisplanwillbeincludedinthefront—endspeci?cations.Subtask3.7-FinalQualityCheckCONSULTANTshallprovidea?nalin-housequalitycheckatthedrawingsandspeclilcatlonsusinganindependentteamat90percentdesign.Appropriatecheckcommentswillbeincorporatedintothe?naldrawingsandspeci?cations.Task4—ContractorProcurementServicesSubtask4.1-SubmlttalforProcurement.CONSULTANTshallprepareandprovidecopiesofthe100%DrawingsandSpeci?cationsforprocurementofCONTRACTOR.CITYwilldetermineselectionmethodforprocurementofCONTRACTOR.subtask4.2—RespondtoQuestions.CONSULTANTshallrespondtoprospectiveCONTRACTORS’inquiriesregardingvariousaspectsoftheProject.ConsultantshallprepareandIssueuptotwo(2)addenda,InconformancewithCITY'scurrentstandards,asappropriatetoInterpret,clarify.orexpandtheProcurementDocuments.1000EnolewoodParkway.Englewood.Colorado80110-2373(303)762-2300www.englawoodgov.orgI5!SAlI1.5S!ipdiiuInjminum...usmmPage 258 of 319 Subtask4.3—AssistinContractorSelection.CONSULTANTshallassisttheCITYinselectingaCONTRACTORfortheproject.Dellverablesforthisprojectincludethefollowing:-MonthlyProgressReportsandInvoices;PDF?lesprovidedbyemailtotheCITY'SProjectManager.-Meetingagendas,meetingsummaries;PDF?lesbye-mail.-PreliminaryDeslgnDrawings;?ve(5)half-sizecopieswillbeprovidedalongwithPDF?les.-FinalDeslgnDrawingsandSpeci?cations(60%and90%);?ve(5)half-slzeoopieswillbeprovidedalongwithPDF?les.-CostEstimates(60%and90%);PDF?lesbye—mall.-100%DrawingsandSpeci?cations;?ve(5)oopieswillbeprovidedalongwithPDF?lesandAutoCAD2015format.7.SPECIALTERMS,IFANYNoneIdenti?ed.8.MODEOFPAYMENTTheCITYandCONSULTANThaveestablishedanot-to-exceedbudgetof$380,400forthescopeatservicesdescribedinthisletter.CONSULTANTshallsubmitthe100percentDrawingsandSpeci?cationswlthlnseven(7)monthsfromwrittenNoticetoProceed.9.PAYMENTSCHEDULECITYwillpayCONSULTANTfortheworkonamonthlybasisbasedontheprojectpercentcomplete.ascalculatedbytheCONSULTANT.CONSULTANTshallprovidemonthlyprogressreportsdetailingworkcompletedInthatmonthforapprovalbyCITV.1000EnglawoodParkway,Englewood,Colorado80110-2373(303)762-2300wvw4.eng|mnudgw.orgvs.un.:aPlprlillr1.1;...“-.Dnlguur.wurrlrPage 259 of 319 10.SCHEDULEANDPERFORMANCEMILESTONESThisschedulesetsforthetargetdatesandperformancemilestonesforthepreparationanddeliveryoftheDellverablesbyCONSULTANT‘PerformanceMilestoneResponsibleTargetDatePa?y(Calendarclays)NoticetoProceedCITYTBD(Day0)Kick-OffMeetingCONSULTANT21daysPreliminaryDesignDeliverableCONSULTANT42daysPreliminaryDesignWorkshopCONSULTANT49daysCommentsReceivedonPreliminaryDesignCITY56daysDeliverable60%DesignDeliverableCONSULTANT84days60%WorkshopCONSULTANT91daysCommentsReceivedon60%DesignCITY98daysDeliverable90%DesignDeliverableCONSULTANT140days90%WorkshopCONSULTANT147daysCommentsReceivedon90%DeliverableCITY154days100%DesignDeliverableCONSULTANT182days11.ACCEPTANCEANDTESTINGPROCEDURESNotapplicable.12.LOCATIONOFWORKFACILITIESSubstantiallyalloftheworkwillbeconduciedbyCONSULTANTatitsregularof?oelocatedinEroom?eld,Colorado.1000EnglawuodParkway.Englawuud.Colorado80110-2373(303)762-2300vMw.eng|ewoodgov.orgr-5»./wasrrwlminimimnuim./2wwvrPage 260 of 319 INWITNESSWHEREOF,pursuantandinaccordancewiththeProfessionalServicesAgreementbetweenthepartiesheretodated,2017.thepartieshaveexecutedthisStatementofWorkasofthisdayof.2017.CITYOFENGLEWOOD,COLORADOBy:(SIgnature)(FnmName)Tme:Date:CAROLLOENGINEERSINCCONSULTANTNameTitle:mgEre<.'g£+Date:‘’By:Slgnalure)HM(ég?/[ml(PrlntNImu)Title:VlcéErna:-oé-4:’Date:9-54‘)1000EnglewnndParkway.Englewuod.Colorado80110-2373(303)762-2300www.eng|ewocdgov.orgIISAIIY-inr-.,..m..n-gm».DennauswwnvPage 261 of 319 Littleton/Englewood Wastewater Treatment Plant BIOGAS USE APPLICATIONS REPORT REVISED DRAFT | September 2017 Page 262 of 319 Page 263 of 319 Littleton/Englewood Wastewater Treatment Plant BIOGAS USE APPLICATIONS REPORT Becky J. Luna, September 8, 2017, Colorado License No. 39920 Page 264 of 319 Page 265 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| i pw:\\Carollo/Documents\Client/CO/LE WWTP/10459A00/Deliverables\LE BiogasUseRpt.docx Contents Biogas Use Applications Report 1 1.1 Introduction 1 1.2 Project Background 1 1.2.1 L/EWWTP Process 1 1.2.2 Existing Digestion System 2 1.3 Biogas Utilization Alternatives Analysis 5 1.3.1 Project Baseline 5 1.3.2 Compressed Natural Gas for Vehicle Fuel 5 1.3.3 Pipeline Injection 9 1.4 Incentives/Grants for Biogas to Transportation Fuel 11 1.4.1 Environmental Protection Agency’s Renewable Fuel Standard Program 11 1.4.2 ALT Fuels Colorado Program 12 1.5 Gas Conditioning 13 1.5.1 Hydrogen Sulfide 13 1.5.2 Moisture 15 1.5.3 Siloxanes 15 1.5.4 Carbon Dioxide 15 1.5.5 Summary of Manufacturers 15 1.6 Biogas Storage 16 1.7 Economic and Non-Economic Comparison 17 1.7.1 Capital Cost Evaluation 17 1.7.2 Life Cycle Cost Evaluation 18 1.7.3 Non-economic Considerations 19 1.8 Financing and Procurement Options 21 1.9 Summary and Recommendations 23 1.9.1 Sensitivity Analyses 24 1.9.2 Exit Strategies 26 1.10 Implementation Plan 26 Page 266 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS APPLICATIONS REPORT ii | SEPTEMBER 2017| REVISED DRAFT Appendices Appendix A Xcel RNG Quality Requirements Appendix B Capital Cost Estimates Tables Table 1 Biogas Quality 4 Table 2 CNG Vehicle Fuel Project Status 6 Table 3 Biogas Production Equivalents 8 Table 4 Pipeline Injection Project Status 10 Table 5 Xcel RNG Biogas Quality Requirements 10 Table 6 Summary of Conditioning Equipment Manufacturers 15 Table 7 Design Criteria and Financial Assumptions 17 Table 8 Estimated Project Costs 17 Table 9 Design Criteria and Financial Assumptions 18 Table 10 Net Present Value Summary 18 Table 11 Non-Economic Comparison of Alternatives 19 Table 12 Factors Used to Calculate GHG Emissions from Biogas Production and Reuse 20 Table 13 Net Present Value at Varying RIN Values 24 Table 14 Net Present Value with Varying Financing Options 25 Figures Figure 1 Digestion Complex Site Plan 2 Figure 2 Historical Biogas Production 3 Figure 3 Influent and Biogas Flow Projections 4 Figure 4 Proposed Gas Conditioning Skid Site Plan 7 Figure 5 Potential Routes for CNG Pipeline to WM Fueling Station 9 Figure 6 Renewable Fuel Volume Mandates 11 Figure 7 Historical D3 RIN Values 12 Figure 8 Typical Treatment Skid for CNG 13 Figure 9 Digester Gas Conditioning System in Grand Junction 16 Figure 10 High Pressure Storage Tubes for CNG 16 Figure 11 Summary of Capital Costs and Life Cycle Revenue 19 Figure 12 GHG Offsets Based on Type of Biogas Reuse 21 Page 267 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| iii Figure 13 Future Site Plan 23 Figure 14 RIN Pricing Sensitivity 24 Figure 15 Financing Sensitivity 25 Figure 16 Implementation Schedule 26 Page 268 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS APPLICATIONS REPORT iv | SEPTEMBER 2017| REVISED DRAFT -This Page Intentionally Left Blank- Page 269 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| v Abbreviations AACE American Association of Cost Engineering BTU British thermal unit Carollo Carollo Engineers, Inc. CDOT Colorado Department of Transportation CEO Colorado Energy Office cf cubic feet cfd cubic feet per day cfm cubic feet per minute cfs cubic feet per second CH4 methane CMAR Construction Management at Risk CNG compressed natural gas CO2 carbon dioxide CO2e carbon dioxide equivalence DAFT dissolved air flotation thickener DGE diesel gallon equivalents EPA Environmental Protection Agency’ F Fahrenheit GGE gasoline gallon equivalents GHG greenhouse gas GWP Global Warming Potential H2S hydrogen sulfide HFC hydrofluorocarbons HHV higher heating value L/EWWTP Littleton/Englewood Wastewater Treatment Plant MG million gallons mgd million gallons per day N2O nitrous oxide NaOH sodium hydroxide O&M operation and maintenance PFC perfluorocarbons Page 270 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT vi | SEPTEMBER 2017| REVISED DRAFT ppd pounds per day ppm parts per million psi pounds per square inch RAQC Regional Air Quality Council RFS Renewable Fuel Standard RIN Renewable Identification Number RNG renewable natural gas RTD Regional Transportation District RTU remote terminal unit scf standard cubic feet SF6 sulfur hexafluoride SO2 sulfur dioxide UPS United Parcel Service VOC volatile organic compound WM Waste Management Page 271 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 1 BIOGAS USE APPLICATIONS REPORT 1.1 Introduction The Littleton/Englewood Wastewater Treatment Plant (L/EWWTP) serves the south metro Denver area and receives sanitary sewer from the Cities of Littleton and Englewood, as well as from 19 other connector districts. The facility was commissioned in 1977 and is currently rated for 50 million gallons per day (mgd), with an approximate average daily flow of 24 mgd. Biogas produced during the anaerobic digestion process is currently used for digester heating, with the remainder (approximately 40 percent of the gas produced, depending on the season) flared in a waste gas burner. The L/EWWTP initiated the Biogas Use Applications Project as part of the plant’s Energy Improvement Program to explore opportunities to handle biogas in an environmentally responsible manner by limiting biogas combustion byproducts being released to the atmosphere, and to create a revenue stream for the L/EWWTP. This report provides the L/EWWTP with a comprehensive evaluation of various scenarios as a means to beneficially use the L/EWWTP’s biogas, including: • Base Case: Untreated biogas is burned in the existing boiler to maintain anaerobic digester operating temperature (98 degrees Fahrenheit [F]) and the excess gas flared. • Conversion of biogas to compressed natural gas (CNG) for vehicle fueling. • Conversion of biogas to CNG for pipeline injection and subsequent distribution for transportation applications by a 3rd party. 1.2 Project Background This project is part of the City of Englewood's Energy Action Plan, the goal of which is "to reduce total energy use 1 percent annually through 2030, which would compound to reducing total energy use by 12 percent over the 2015 baseline by that time." The L/EWWTP is listed in one of the three areas that Englewood will focus on, "Municipal/Institutional." The entire focus area accounts for 8 percent of the electricity and 1 percent of the natural gas, or 3 to 4 percent of the total community energy use. The L/EWWTP accounts for 76 percent of the area's energy use, and can therefore have a significant impact on Englewood's Energy Action Plan. The project goals include: • Develop renewable energy. • Convert biogas into a revenue source. • Highlight the L/EWWTP as a community resource. • Evaluate partnering with neighboring industries. • Determine technical feasibility and economic viability of beneficially reusing biogas. 1.2.1 L/EWWTP Process The L/EWWTP consists of a headworks, primary treatment, secondary treatment consisting of trickling filters/solids contact system, followed by nitrification trickling filters, denitrification basins, and chlorine disinfection prior to discharge to the South Platte River. Solids treatment includes co-thickening of primary and secondary solids in dissolved air flotation thickeners (DAFT), anaerobic digestion, and centrifuge dewatering. Page 272 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 2 | SEPTEMBER 2017| REVISED DRAFT 1.2.2 Existing Digestion System The L/EWWTP currently produces roughly 40,000 pounds per day (ppd) of primary and secondary volatile solids, with a buildout production of almost 80,000 ppd (L/EWWTP Master Plan, October 2013). Primary sludge, scum, and secondary sludge are thickened together in the DAFT process and the thickened sludge is pumped to the digesters. The digestion process consists of five anaerobic digesters that are 80 feet in diameter and designed for 29 feet of sidewall depth, for a volume of just over one million gallons (MG) per digester. Digesters 1, 3, 4, and 5 are considered primary digesters and are mixed and heated. Digester 2 is equipped with two mixing pumps and a transfer pump. Under normal operation, only two digesters are in service at a time, and Digester 2 serves as an active storage digester, which receives and stores the digested sludge prior to dewatering. An aerial view of the digestion system is shown in Figure 1. Figure 1 Digestion Complex Site Plan After dewatering, the biosolids are land applied in Adams and Arapahoe counties. The L/EWWTP produces approximately 3,400 dry tons per year of biosolids. Almost three-quarters of the biosolids are applied to land owned by Littleton and Englewood, and the remainder is applied to private lands. 1.2.2.1 Existing Biogas System Gas produced in the digesters is currently collected in the headspace of the operating digesters and connected to a biogas header. Gas pressure is maintained at a set point by the backpressure Page 273 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 3 control valve at the waste gas flare. Pressure and vacuum relief assemblies are located on each digester roof to protect the digesters in case of a blockage in the piping. A portion of the biogas is burned to heat the primary digesters in the dual-fired boilers. The L/EWWTP has two Jenbacher cogeneration engines and ancillary equipment, though they have not been used since 2005. Gas treatment was not installed with the cogeneration equipment, and burning the raw biogas created operational issues for the engines due to siloxane buildup. Based on the evaluation performed in the 2013 Master Plan, L/E has elected to abandon the cogeneration engines due to the high cost of maintenance (estimated to be approximately $900,000 per year for a contract services agreement). 1.2.2.2 Biogas Production and Quality Gas production at the facility during 2016 is presented in Figure 2. This figure shows the total biogas production and biogas consumed in the boilers to heat the process and building. The remainder is flared. Based on the operating data, gas production fluctuates between approximately 400,000 and 1,000,000 cubic feet per day (cfd) with an average of 469,000 cfd. While only 1 year of data is shown, this is typical of historical plant operation. Figure 2 Historical Biogas Production To determine the future gas flows, Carollo Engineers (Carollo) initially used a ratio of current and future average day annual influent flow projections developed for the 2013 Master Plan based on service area population projections. The Master Plan over-predicted the flow in 2015, so Carollo lowered the projection to match the growth from 2010 to 2015. Based on the revised projections, gas production is anticipated to increase from 469,000 cfd in 2015 to 556,700 cfd in 2038. Figure 3 presents both influent flow and biogas flow projections between 2015 and 2038. This increase in flow and biogas production equates to approximately a 1 percent growth of L/EWWTP’s service area. Carollo estimates this growth is due to urban infill and not increasing the service area. 0 200,000 400,000 600,000 800,000 1,000,000 1,200,000 Gas Produciton, cfdTotal Digester Gas Produced Digester Gas Flow to Boilers Page 274 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 4 | SEPTEMBER 2017| REVISED DRAFT Figure 3 Influent and Biogas Flow Projections The quality of the gas will determine the level of treatment required for the various alternatives evaluated herein. The L/EWWTP provided historical biogas quality data, including heating value, methane (CH4) concentration, carbon dioxide (CO2) concentration, and hydrogen sulfide (H2S) concentration, as shown in Table 1. The L/EWWTP tests the gas roughly every 2 weeks. Table 1 Biogas Quality CH4 (%) CO2 (%) H2S (ppm) Siloxane (ppm) Heating value (BTU/scf)(1) Average 58 40 157 <1 443 Maximum 59 42 231 1.3 457 Minimum 55 38 25 <1 427 Notes: (1) Based on Carollo's experience, the heating values are lower than expected. A different calculation method used by a third party lab resulted in a heating value of 600 BTU/scf. The value used in this analysis is 550 BTU/scf, adopted from the 2013 Master Plan. BTU = British thermal unit ppm = parts per million scf = standard cubic feet With the exception of the heating value (explained in the table footnote), these values are all within normal ranges for a municipal L/EWWTP. 1.2.2.3 Digester Heating Requirement The heating system comprises of three boilers, a primary heat reservoir loop and multiple secondary heat reservoir loops. As shown in Figure 2, an average of 103,900 cfd of biogas is sent to the boilers for heating, with a demand as high as 231,900 cfd in the winter months. For this evaluation, biogas consumption in the boiler of 103,900 cfd was used as the starting point in 2018. The amount of gas required was assumed to increase at the same rate the influent flow - 100,000 200,000 300,000 400,000 500,000 600,000 0 5 10 15 20 25 30 2015 2020 2025 2030 2035 2040 Gas Production, cfdInfluent Flow, mgdYear Influent Flow Digester Gas Flow Page 275 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 5 increased, to 119,700 cfd in 2038. These gas flows correspond to heat demands of 57.1 million BTUs/day and 65.8 million BTUs/day, respectively. 1.3 Biogas Utilization Alternatives Analysis Prior to initiating this project, the L/EWWTP team evaluated a number of options to beneficially re-use the biogas produced on-site. These alternatives were compared to current operation (use biogas to heat digesters and flare excess gas) and included: • Reinvesting in cogeneration facilities, • Conversion of biogas to CNG for vehicle fueling, • Conversion of biogas to CNG for pipeline injection, • Biogas supply to local industries, • Bioplastic generation from biogas, and • Biosolids drying. Based on previous experience with their cogeneration system, plant staff elected to not pursue reinvestment in cogeneration facilities. Biogas supply to local industries was deemed to be less economically favorable as compared to the conversion of biogas to CNG. Bioplastic generation from biogas was not evaluated further due to its lack of implementation at full scale. Biosolids drying was found to have a significantly higher capital cost than the other alternatives based on evaluations at other facilities, and was dropped from consideration. As a result of the L/EWWTP evaluations, the team determined that the two options to be evaluated as part of this project are as follows: • Conversion of biogas to CNG for vehicle fueling, and • Conversion of biogas to CNG for pipeline injection. The sections below present the findings related to evaluating the feasibility, costs, advantages, and disadvantages of these two alternatives as compared to the project baseline. 1.3.1 Project Baseline The project baseline represents the current operation of the L/EWWTP, for comparison to the alternatives presented herein. Under this scenario, the L/EWWTP would continue to burn the untreated biogas in the boiler to heat the primary digesters under typical operation, while flaring the excess gas in the existing waste gas burner, as described in Section 1.2. This alternative is presented as a "do nothing" alternative and would not incur additional capital or operating costs, but would not accomplish the L/EWWTP’s goals of finding a beneficial use for the biogas and creating a revenue stream. 1.3.2 Compressed Natural Gas for Vehicle Fuel Use of biogas for the production of CNG for vehicle fuel has gained increasing interest over the past decade due to the economic benefit of offsetting vehicle fuel rather than electricity. With municipal fleet and private sector vehicles across the country converting to CNG, there is a great opportunity for collaboration by locating vehicle fueling stations near existing wastewater treatment plants and making use of an already available fuel source. While implementation of these types of projects at wastewater treatment plants is relatively new, the technology for conditioning and compressing the gas into CNG is well-established, and is currently in use at landfills across the country. Newly developed regulations and goals geared Page 276 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 6 | SEPTEMBER 2017| REVISED DRAFT toward greenhouse gas (GHG) emission reductions are providing newfound incentives for implementing these types of projects. Table 2 summarizes projects that have been completed or are underway to convert biogas to CNG for vehicle fuel at wastewater treatment plants in the United States. Table 2 CNG Vehicle Fuel Project Status Project Location Average Dry Weather Flow Production Since Biogas Utilization City of Janesville, WI 13 mgd 2012 CNG for vehicle fuel City of Grand Junction, CO 8 mgd 2015 CNG for vehicle fuel St. Petersburg, FL 35 mgd 2015 CNG for vehicle fuel Napa Sanitation District, CA 9 mgd In Progress CNG for vehicle fuel Columbia Boulevard Water Treatment Plant, OR 100 mgd City Council approved; design not yet begun CNG for vehicle fuel City of San Mateo, CA 12 mgd 2016 CNG for vehicle fuel City of Porterville, CA 5 mgd Evaluation complete; design not yet begun CNG for vehicle fuel Petaluma, CA 5 mgd In Design; Construction to begin in 2017 CNG for vehicle fuel The required equipment for this alternative consists of treatment, compression, storage, and a fueling station. In order to produce CNG, the biogas is cleaned to remove H2S, siloxanes, moisture, and the majority of CO2, resulting in greater than 95 percent CH4 content. After treatment, the gas is compressed and stored for use. This system converts a majority of the gas to CNG, and the remaining gas, known as the tail gas (approximately 30 percent of the initial CH4 content, along with the stripped CO2 depending on treatment method) can either be flared or potentially burned in the existing boiler, either with natural gas blending or by itself. This tail gas has a heating value lower than normal biogas. Another option is to provide an extra treatment step (an additional set of membranes) for additional CO2 removal. This increases the efficiency of the gas conditioning system from 70 percent to 95 percent, but requires a thermal oxidizing flare or similar technology for disposal of the very low BTU waste gas, since it contains mostly CO2. For the purposes of this analysis, a dual pass conditioning system was assumed, which has a higher capital cost, but a lower overall payback period, due to the increased utilization of the digester gas. A proposed layout of the gas conditioning skid on the L/EWWTP plant site is presented in Figure 4. The skid can be located outdoors on a concrete pad. An alternate location for the equipment could be in the existing cogeneration room, if the existing units are removed. Page 277 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 7 Figure 4 Proposed Gas Conditioning Skid Site Plan A typical CNG fueling station receives natural gas from a pipeline and uses compressors to pressurize the gas to supply either fast-fill or slow-fill fueling stations. Fast-fill fueling stations compress CNG to roughly 3,000 pounds per square inch. At this pressure, it takes roughly the same amount of time to fill a CNG vehicle as a traditional gasoline or diesel powered vehicle. Slow-fill fueling stations are often used for fleet vehicles that are not in operation for a significant portion of the day. For these stations, the gas is pressurized to 2,000 pounds per square inch (psi) and is fed to the vehicles overnight so that they are ready for use the next day. This evaluation considered several possible users that had a large fleet of vehicles that could use the CNG produced at the L/EWWTP, including the United Parcel Service (UPS), Safeway, Western Disposal, Regional Transportation District (RTD), Waste Management (WM), and Englewood Schools, among others. Englewood Fleet Services was considered, but would not have sufficient fuel usage use to make the project economically viable. Many of the potential users considered already have fueling on-site, and are not located within a reasonable distance for a pipeline to be installed between the L/EWWTP and the existing fueling station. The most feasible alternative was WM. The WM refueling and parking site is less than 3 miles from the L/EWWTP and currently has 40 CNG trucks, with plans to purchase 60 more in the future. WM operates more than 5,000 CNG powered trucks in North America, and would bring significant experience to the project. A fast-fill fueling station closer to the L/EWWTP was briefly considered, but the production from the L/EWWTP is relatively constant throughout the day and night, and a large portion of biogas Page 278 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 8 | SEPTEMBER 2017| REVISED DRAFT would be wasted without including significant and costly storage volume. Additionally, WM already has slow-fill fueling stations constructed at their site. Based on conversations with WM, this analysis assumes the WM trucks drive an average of 75 miles per day and have an efficiency of 2 miles per gallon. Based on these assumptions, the fleet would require 1,500 diesel gallon equivalents (DGE) of CNG fuel per day. The equivalent BTU value, DGEs, and equivalent vehicle miles per day based on the L/EWWTP's current and future biogas production are presented in Table 3. This analysis shows that the L/EWWTP produces in excess of what is required by Waste Management's fleet. The limiting factor for WM use is their operational schedule of 5.5 days per week. Table 3 Biogas Production Equivalents Year Biogas Production, cfd BTUs Generated/Day DGEs/Day Equivalent Vehicle Miles/Day 2015 468,600 257,730,000 1,800 3,600 2038 556,700 306,185,000 2,200 4,400 Notes: (1) Assumes 550 BTU/cf, 129,500 BTU/DGE, and 95% efficiency of dual pass biogas conditioning system and 96% availability. (2) Assumes CNG sanitation vehicles achieve a fuel efficiency of 2 miles per DGE. The fueling station would be designed to use either CNG from the L/EWWTP or natural gas (as it is currently operated). The fuel system would utilize a pressure regulating valve so that CNG is used before the currently supplied natural gas. During times when production exceeds demand, the excess can either be stored, or flared if storage is full. Gas production in excess of use and storage can be used in the boilers. The WM fleet is currently based at 2400 W. Union Avenue, Englewood, CO 80110. The team evaluated the construction of a pipeline between the L/EWWTP and WM, likely routed down Santa Fe Drive, as shown in Figure 5. The cost of the pipeline itself is anticipated to be roughly $1 million dollars for material and installation costs (trenching and tunneling under the South Platte River). The routing of this pipeline, although small in diameter, poses concerns with respect to coordination with landowners and permitting, given that it would be routed through a congested area and below the South Platte River. This could add project complexity and result in schedule delays. Another concern with this alternative (beyond routing the pipeline) is that once a pipeline is constructed, the L/EWWTP is tied to WM without other customers to sell to. In the future, L/E could install a CNG fueling station for the public along Santa Fe Drive, but the demand of this fueling station is unknown, and would likely be significantly lower than the demand from WM. One advantage of this alternative is that it would meet the L/EWWTP’s strategic plan objective of creating regional partnerships to benefit members of the community. Page 279 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 9 Figure 5 Potential Routes for CNG Pipeline to WM Fueling Station 1.3.3 Pipeline Injection Another use of CNG is direct injection into a pipeline for a third party vehicle fuel use. This alternative requires additional cleaning of the biogas beyond CNG vehicle fuel standards, but eliminates the need for storage and the concerns over finding sufficient consistent demand for the produced gas. Table 4 summarizes projects that have been completed or are underway to convert biogas to CNG for pipeline injection at wastewater treatment plants in the United States. Page 280 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 10 | SEPTEMBER 2017| REVISED DRAFT Table 4 Pipeline Injection Project Status Project Location Average Dry Weather Flow Production Since Biogas Utilization Point Loma, CA 240 mgd 2012 Pipeline injection Clean Water Services, OR 65 mgd 2017 Pipeline injection Raleigh, NC 44 mgd Construction to begin in 2018 Pipeline injection Des Moines, IA Construction to begin in 2017 Pipeline injection South Bend, IN 48 mgd Completion expected September 2017 Pipeline injection For this alternative, the biogas is treated to remove siloxanes, H2S, CO2, and moisture, undergoes compression, and is then injected into a natural gas supply pipeline. Pipeline injection requires a similar treatment of the gas as CNG for vehicles, but would require an extra treatment step (an additional set of membranes) for additional CO2 removal. This would also require a thermal oxidizing flare or similar technology for disposal of the very low BTU waste gas, since it contains mostly CO2. The proposed location of this gas conditioning system is the same as that of the CNG fueling option, as shown in Figure 4. The current and future production of CNG would be the same as that of the alternative above, shown in Table 3. Carollo identified the Xcel Energy, the local natural gas utility, as the owner of the local natural gas pipelines. Xcel indicated that they are amenable to receiving the treated gas, providing it meets their Colorado Gas Tariff renewable natural gas (RNG) specifications, shown in Table 5. On behalf of L/EWWTP, Carollo filled out Xcel's "RNG Evaluation Form" and in response, Xcel has shown support for the project and will work with L/EWWTP to form an agreement. Xcel has indicated that the L/EWWTP also must meet several additional “tariff silent” requirements, included in Appendix A. Based on conversations with Unison Solutions, a manufacturer of biogas conditioning systems, these quality requirements can be met. Xcel Energy also confirmed the best location to connect to the system is on the northern boundary of the plant site to an existing natural gas pipe that operates at 150 psi. Table 5 Xcel RNG Biogas Quality Requirements Constituents/Properties Limit Units Higher Heating Value (HHV) 965-1,100 BTU/scf Wobbe (based on HHV) 1,185-1,285 Carbon Dioxide (mol %) 3.0 mol % Oxygen 2.0 mol % Total Inerts 14.3 mol % H2S) 0.25 (4) gr/Cscf (ppmv) Total Sulfur 5.0 (85) gr/Cscf (ppmv) Hydrocarbon Dew Point Cricondentherm 15 degrees F Water Vapor Content 3 lb/MMscf Dust, Dirt, Scum, and Other Solids Free of Water and Hydrocarbons in Liquid Form Free of Temperature 32-110 degrees F Page 281 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 11 Xcel Energy requires equipment for injection into their system, including a gas chromatograph, flowmeter, regulator, remote terminal unit (RTU), gas odorizer, emergency shut-off valve, and other ancillary equipment. The installed cost of the equipment was estimated to be $1,050,000. This equipment will be designed and installed by Xcel Energy. The principal benefit of pipeline injection is that 100 percent of the generated biogas can be sold to offset vehicle fuel, instead of being limited by Waste Management's lack of nighttime and weekend operation. 1.4 Incentives/Grants for Biogas to Transportation Fuel With increasing public pressure to reduce the country’s reliance on non-renewable vehicle fuels, several programs, and incentives have been designed to offset fossil fuel use and decrease GHG emissions. 1.4.1 Environmental Protection Agency’s Renewable Fuel Standard Program The Environmental Protection Agency’s (EPA) Renewable Fuel Standard (RFS) Program was created under the Energy Policy Act of 2005, (https://www.epa.gov/renewable-fuel-standard- program), and established the first renewable fuel volume mandate in the United States. The program requires oil and gas producers to purchase specified amounts of fuel credits each year to increase the amount of renewable fuel used. Each 77,000 BTUs of gas used for vehicle fuel generates a renewable credit with a specific identification number, named the Renewable Identification Number (RIN). The RFS program defines four types of renewable fuels: cellulosic biofuel, biomass-based diesel, advanced biofuel, and renewable fuel. As of 2014, the RFS program allows digester biogas from municipal wastewater treatment facility digesters as a transportation fuel feedstock. The biogas is designated as a “cellulosic” (D3) feedstock, which carries the greatest RIN value of the four categories. The mandated quantities of renewable fuel volumes have been set through 2022, as shown in Figure 6. Beyond 2022, fuel volume mandates will be set by the EPA administrator. Figure 6 Renewable Fuel Volume Mandates Page 282 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 12 | SEPTEMBER 2017| REVISED DRAFT RINs are traded on the open market, and their value is dependent upon the price of oil and the renewable volume obligation, which is the amount of RINs obligated parties have to purchase. When D3 RINs were first introduced into the market 3 years ago, they had a value of approximately $1.00 per RIN. D3 RINs are currently trading for $2.50, with a 3-year historical average of $1.78. As demand for RIN credits associated with cellulosic biofuels grows, the expectation is that RINs will have an increasing market value over time. For the purposes of this evaluation, the currently traded value of $2.50 was used. Figure 7 presents the historical average RIN value for D3 RINs from 2015 through present day. Figure 7 Historical D3 RIN Values In order to become a RIN producer, the L/EWWTP must be certified with the EPA. This is typically done by a third-party carbon offset broker. Carbon offset brokers can provide RIN registration and ongoing reporting and management. The carbon offset brokers also handle the sale of RINs to producers. In exchange, they receive a management fee based on an agreed upon percentage of the RIN value, anticipated to be 20 percent for this size of project. For pipeline injection projects, the carbon offset brokers also manage the sale of the injected CNG. Another option is for an obligated party (i.e., oil and gas producer) to purchase the RINs directly from the L/EWWTP. L/EWWTP and Carollo have discussed this with British Petroleum, and they have expressed interest in the project. Both options result in the sale of the CNG and RIN credits, and would include similar amounts of work for L/EWWTP. Differences could include the length of contract, contractual obligations, and pricing structure. A priority for bidding the project would be determining an effective way to compare the two options and the risk/value propositions associated with their contract structures. 1.4.2 ALT Fuels Colorado Program The Colorado Energy Office (CEO), the Regional Air Quality Council (RAQC), and the Colorado Department of Transportation (CDOT) provide grants through the ALT Fuels Colorado program for a variety of alternative fueling infrastructure, including new, publicly accessible CNG fueling equipment; co-located electric vehicle charging and propane station equipment at funded CNG stations; and CNG, propane, and electric vehicles. The ALT Fuels Colorado grant program is a partnership between the CEO and the RAQC, created to award grants for partial funding of CNG fueling station equipment, and co-located electric vehicle charging and propane auto gas station equipment. ALT Fuels Colorado will distribute approximately $30 million over 4 years (between 2014 and 2017) to incentivize adoption of alternative fuel vehicles. Since Waste Management already has fueling stations and pipeline injection does not include fueling infrastructure, Page 283 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 13 ALT Fuels grants for a fueling station will likely not apply. In addition, it would be difficult to get funding through this program since it is anticipated to conclude at the end of this calendar year. 1.5 Gas Conditioning Both of the alternatives above require gas conditioning treatment to remove impurities such as H2S and siloxane compounds, followed by removal of the majority of the CO2, resulting in greater than 95 percent CH4 in the gas. Conversion of biogas for pipeline injection requires a second step to remove additional CO2, resulting in greater than 99 percent CH4 in the gas. The gas conditioning systems use well-proven technologies to remove the undesired constituents. A typical gas treatment schematic for CNG and pipeline injection is presented in Figure 8. Figure 8 Typical Treatment Skid for CNG Treatment processes for biogas typically fall into two groups: physical or chemical/biological removal. Water vapor, CO2, and particulates are removed by physical processes, while volatile organic compounds (VOC), halogenated organics, H2S, and siloxane compounds are removed by either chemical or biological treatment. The various compounds and their treatment systems are explained below. 1.5.1 Hydrogen Sulfide H2S is a highly reduced compound that readily binds with most metals and is abundant in biogas. During combustion, H2S reacts with oxygen creating sulfur, sulfur dioxide (SO2), sulfite (SO3), and sulfate (SO4). All of these compounds are known as SOx, and they are regulated as air pollutants. Additionally, oxidized sulfur compounds will react with water to form sulfuric acid. Sulfuric acid corrodes downstream equipment, resulting in increased maintenance and reduced service life. H2S can be removed from biogas by the use of iron salt addition to the sludge, iron adsorption, caustic scrubbing, or biological treatment. 1.5.1.1 Iron Salt Addition The use of iron salts for mitigation of H2S is widespread among wastewater utilities and is currently used at the L/EWWTP. Both ferric chloride and ferrous chloride can be added directly to the anaerobic digesters. Typical dosage rates for ferric chloride and ferrous chloride are 3.2 and 3.7 grams per gram of H2S. Other benefits from iron salt addition to anaerobic digesters include precipitation of phosphorus and increased degradability of grease. Disadvantages of iron salt addition include increased sludge volumes and the potential for formation of vivianite scale in piping, heat exchangers, and digesters. Page 284 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 14 | SEPTEMBER 2017| REVISED DRAFT 1.5.1.2 Iron Adsorption The oldest commercial process for removing H2S from gas is “iron sponge” which has been in use for more than 100 years. Iron sponge normally has the lowest initial cost of all commercial processes. The iron sponge concept is quite simple: hydrated iron oxide is impregnated onto redwood chips, creating a reactive media for the H2S. The spent wood chip media is non- hazardous, must be replaced, and can be used as a soil fertilizer. Servicing typically requires that spent wood chip media be removed with 6,000 psi water jet, shovel and/or be vacuumed out. An alternative form of solid media H2S removal system is termed “sulfa treat” and uses iron- based chemistry but uses a different media base. Sulfa treat is a dry, free-flowing iron oxide- based media that selectively removes H2S and some light mercaptans. The solid, clay-like media is an inorganic ceramic coated material coated with an iron oxide. The iron oxide reacts with the H2S to form iron pyrite. Adsorption media firms have developed proprietary media that more effectively remove H2S while increasing the capacity of the media. These newer media generally have higher capital cost but require less frequent replacement. 1.5.1.3 Water Scrubbing (Caustic Scrubbers) Caustic scrubbers are recirculating liquid packed towers, which use elevated pH to transfer H2S from the gas stream to a sodium hydroxide (NaOH) solution. This type of system utilizes a large quantity of water in a single pass arrangement. If a secondary effluent water source can be readily obtained and if the water can be returned downstream of the secondary process, this method can be cost effective. Removal of approximately 80 percent of the sulfur compounds can be expected from such systems. This method is typically economically feasible only for large gas flow rates (larger than 1,000 cfm). 1.5.1.4 Biological Treatment Biological treatment systems are now coming onto the market for removal of sulfur compounds from biogas. These systems are nearly identical to water scrubbing systems except that the system utilizes a much lower amount of water in a recycle system. Biological systems consist of a packed tower in which biogas travels upwards through packing while recirculated water is sprayed down onto the packing. Biological growth occurs on the packing, which reduces the sulfur compounds in an identical manner to biological odor scrubbers. This type of system utilizes a very small quantity of secondary effluent water. Removal of approximately 95 percent of the sulfur compounds can be expected from such systems. As sulfur compounds are reduced by biological treatment, no significant sulfur loading would occur in the plant. 1.5.1.5 Recommended H2S Treatment Due to the current iron salt addition and resulting relatively low H2S concentrations in the L/EWWTP's biogas, the recommended treatment method is media based adsorption. The hydrogen sulfide concentrations after the iron salt addition are not high enough to warrant a biological system and the flows are not high enough to make a caustic scrubber feasible. The exact type of media will be determined along with the system's manufacturer and will consider effectiveness, capacity, price, and maintenance concerns, such as ease of removal and replacement. Page 285 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 15 1.5.2 Moisture The common and recommended moisture removal treatment is a refrigeration process that chills the gas, condensing the moisture. Upstream of the cooling portion of treatment, a coalescing filter removes any particles in order to maintain the effectiveness of the heat exchangers. Glycol is air-cooled using a refrigeration unit and is circulated through a heat exchanger to cool the gas. Once the gas is below the dew point, the moisture condenses and drops out, to either be automatically removed by a drip trap or condensate accumulator. The gas leaves the process and is compressed to reheat and pressurize the gas. This is a very commonly used and well-proven system that operates automatically with minimal maintenance. 1.5.3 Siloxanes Siloxanes are cyclic organic silicon monomers used in the manufacture of personal hygiene, health care, and industrial silicon products, and are typically found in biogas at varying levels. Combustion of biogas containing siloxanes can result in deposits of silica residue on equipment surfaces, impairing performance, and significantly increasing system maintenance. There are several generally accepted siloxane removal methods: single-stage refrigeration, two- stage refrigeration, and adsorption. Adsorption is the recommended method for this project, because of its ability to reliably remove the siloxanes down to the required values for either cogeneration or CNG. Adsorption typically includes an upstream single-stage refrigeration/chiller dryer to remove water and some contaminants. The siloxanes are removed from the biogas by adsorption onto the surface of the desiccant media such as silica gel. Siloxane adsorption can be designed to remove siloxanes down to the minimum detection limit. 1.5.4 Carbon Dioxide The most commonly used and recommended CO2 removal treatment is a membrane separation system. The gas is pressurized and the CH4 is retained on the membrane while the CO2 passes through as tail gas. Some CH4 also passes through into the tail gas, which means the gas needs to be flared. A second membrane step can be added to retain more of the CH4 and create a more pure product (required for pipeline injection). This process requires a thermal flare since the waste gas does not have a high enough BTU value to be burned in a traditional flare. 1.5.5 Summary of Manufacturers Table 6 summarizes the constituents in the raw biogas and the manufacturers that provide the recommended equipment required to remove them. Many of the manufacturers can provide a packaged skid that includes each of the systems below. Table 6 Summary of Conditioning Equipment Manufacturers Constituent Recommended Treatment Method Removal Equipment Manufacturers H2S Adsorption Varec, Clean Methane Systems, ESC, Marcab, MV Technologies, Unison, Biorem, Venture Moisture Refrigeration Clean Methane Systems, ESC, Parker, Perennial Energy, Unison, Venture Siloxane Adsorption Clean Methane Systems, ESC, Marcab, Theia Air, Unison, Venture CO2 Membrane Separation Air Liquide, Unison Page 286 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 16 | SEPTEMBER 2017| REVISED DRAFT Figure 9 shows an example gas conditioning system, located at the Persigo WWTP in Grand Junction, Colorado. Figure 9 Digester Gas Conditioning System in Grand Junction 1.6 Biogas Storage Storage for CNG systems is often required due to the constant production of biogas and intermittent fueling periods. For a fast-fill station, high-pressure storage is required in order to have CNG on-demand. A larger amount of storage results in higher utilization, since overnight production can be stored for daytime dispensation (or vice-versa for slow-fill stations), since gas must be flared when the storage is full. Figure 10 shows an example bank of high pressure storage tubes that would be included for the CNG fueling alternative. Figure 10 High Pressure Storage Tubes for CNG While storage is not required for slow-fill stations, it is recommended for the WM alternative to increase utilization. A portion of the gas produced during the day will be used in the boilers, and the remainder will be stored. If the storage is full and production exceeds demand, the remainder will be flared using the existing flare. At night, the sanitation trucks will be filled from both the production of biogas and from storage. A storage vessel or bank of storage vessels containing roughly half of the L/EWWTP's production, 800 DGE, is recommended for the CNG option. This will maximize the utilization of biogas use by storing gas produced during the day and dispense the gas required to fuel the trucks at night. Page 287 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 17 Storage is not required for the pipeline injection alterative, since CNG would be injected into the pipeline at the same rate it is produced. 1.7 Economic and Non-Economic Comparison The following alternatives were identified as feasible for this facility based on the preliminary assessment and were further evaluated to determine capital and life cycle costs. All of the alternatives were compared to the existing operation, which burns a portion of the biogas to heat the digesters and the remainder is flared. • Alternative 1: Conversion of biogas to CNG for vehicle fueling. A vehicle fueling installation would include a new gas conditioning system to convert the plant’s biogas into vehicle fuel quality natural gas (CNG). An approximately 3-mile pipeline running from the L/EWWTP to the Waste Management fueling site to the south would be built to convey the gas. • Alternative 2: Conversion of biogas to CNG for pipeline injection. Pipeline injection will include installation of a new gas conditioning system to convert the plant’s biogas into pipeline quality CNG. The CNG would be sold to the market and used to generate and sell renewable credits. 1.7.1 Capital Cost Evaluation Carollo's cost estimating software was utilized to develop capital cost estimates for the alternatives listed above and represents a Class 4 Estimate based on the American Association of Cost Engineering (AACE) classification. Equipment quotes were provided by Unison, a manufacturer of gas conditioning and fueling systems. Capital costs presented herein are escalated to the mid-point of construction (assumed to be middle of 2018). Assumptions and allowances for the capital costs are presented in Table 7. Table 7 Design Criteria and Financial Assumptions Criteria Assumption Used Escalation rate 3% Electrical, Instrumentation & Controls Allowance 15% Contingency 20% General Contractor Overhead, Profit, Bonds, and Mobilization 15% Engineering, Legal, and Administrative Fees 15% A summary of the project costs is shown in Table 8. Detailed project cost estimates are provided in Appendix B. Table 8 Estimated Project Costs Alternative Total Project Cost 1. Vehicle Fuel $8,423,000 2. Pipeline Injection $7,500,400 Page 288 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 18 | SEPTEMBER 2017| REVISED DRAFT 1.7.2 Life Cycle Cost Evaluation A life cycle cost for both options was developed, which evaluated the costs and revenues for each option over the estimated life of the equipment (assumed to be 20 years). Assumptions used for the life cycle cost analysis are presented in Table 9. Table 9 Design Criteria and Financial Assumptions Criteria Assumption Used Inflation Rate for capital and Operation and Maintenance (O&M) Costs (fuel, electricity) 3% Gross Discount Rate 4% Biogas HHV, BTU/scf 550 Gas Conditioning System Availability Percentage 96% O&M Cost for Dual Pass Gas Conditioning System , $/GGE $0.54 Natural gas cost, $/therm $0.53 RIN Credit, $/RIN $2.50 CNG Sale Price $/therm $0.20 Notes: GGE = gasoline gallon equivalents To evaluate the benefits and costs of each alternative, the projected capital cost, O&M costs, and anticipated revenues were calculated. The total net present value was then calculated for each alternative. A summary table presenting the life cycle cost for each alternative is shown in Table 10. Table 10 Net Present Value Summary Alternative Vehicle Fuel Pipeline Injection Estimated Capital Cost ($8,423,000) ($7,500,400) Averaged Annual (Costs)/Revenues Revenue for CNG Sale $604,200 $285,800 Revenue for RIN Credit $1,686,400 $2,474,500 Natural Gas Costs ($23,800) ($188,600) O&M Costs ($457,900) ($623,500) 20-Year Present Value of (Costs)/Revenues Revenue for CNG Sale $7,526,400 $3,560,600 Revenue for RIN Credit $21,828,200 $32,028,700 Natural Gas Costs ($296,200) ($2,348,900) O&M Costs ($5,703,400) ($7,766,600) Total 20-Year Net Present Value $14,932,000 $17,973,400 Payback Period (years) 5 4 Figure 11 presents a graphical representation of the capital cost and life cycle revenue of each alternative. Page 289 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 19 Figure 11 Summary of Capital Costs and Life Cycle Revenue The pipeline injection alternative, which includes a dual-pass gas conditioning skid and connection to the Xcel pipeline along the northern border of the plant, has the highest net present value. Based on the revenue generated and the capital cost estimates, this alternative has a 4-year payback based on the assumptions listed above. This alternative would be able to utilize all of the produced biogas. This option would cost the L/EWWTP $7.5 million for the gas conditioning and compression equipment, pipeline through the plant to the Xcel pipeline, and required Xcel energy monitoring equipment, and would generate approximately $18 million in revenues over a 20-year period. 1.7.3 Non-economic Considerations Each of the alternatives was evaluated against the project goals and selected non-economic criteria to determine the best fit for the L/EWWTP. Table 11 presents non-economic advantages and disadvantages for each alternative. Table 11 Non-Economic Comparison of Alternatives Alternative Advantages Disadvantages Conversion of Biogas to CNG for Vehicle Fueling • Development of renewable energy product • Creation of a regional partnership to benefit members of the community • Ability to heat the digester with excess biogas • Project risks associated with pipeline routing • Project risks associated with contracting with a single entity for biogas use • Longer time to market as compared to pipeline injection Conversion of Biogas to CNG for Pipeline Injection • Development of renewable energy product • Higher utilization of biogas as compared to vehicle fueling • Higher reduction in GHG emissions • Shorter time to market as compared to pipeline injection • Cleaner gas provides off-ramp for future technologies • More stringent gas quality requirements as compared to vehicle fueling $(15,000,000.00) $(10,000,000.00) $(5,000,000.00) $- $5,000,000.00 $10,000,000.00 $15,000,000.00 $20,000,000.00 $25,000,000.00 $30,000,000.00 CNG Pipeline Capital Life Cycle Revenue Overall Revenue Page 290 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 20 | SEPTEMBER 2017| REVISED DRAFT 1.7.3.1 Greenhouse Gas Emissions The L/EWWTP has a Strategic Plan Purpose Statement that reads, "Protection of Public Health and the Environment." Both of the evaluated projects will reduce the amount of vehicle miles powered by non-renewable sources, curbing GHG emissions. To quantify the reduction in GHG emissions, a GHG inventory tool was developed for this project. GHG emission reduction can come from directly reducing GHG emissions by consuming less, or from increasing GHG offsets, which provide a positive contribution to net GHG emissions. Quantifying GHG emissions allows utilities the opportunity to plan the most cost- effective means of managing and reducing GHG emissions (or increasing offsets) while minimizing fossil fuel-based energy use and maximizing resource recovery. Six GHGs have been prioritized for GHG inventory purposes, based on each gas’ capacity to absorb and reradiate heat, and thus contribute to climate change. These GHGs include CO2, CH4, nitrous oxide (N2O), hydrofluorocarbons (HFC), perfluorocarbons (PFC), and sulfur hexafluoride (SF6). Of these, CO2, CH4, and N2O are considered relevant for wastewater treatment emissions and are the focus of the inventory. To account for the variation in the ability for each gas to absorb and reradiate heat, Global Warming Potentials (GWP) are used to relate gases to CO2 on a mass basis (e.g., carbon dioxide equivalence or CO2e). An assumption of the time horizon must be made to generate meaningful emissions estimates when selecting GWPs. The typical time horizon selected is 100 years. Based on this time horizon, CH4 and N2O are estimated to have 25 and 298 times the capacity to absorb and reradiate heat relative to CO2, respectively. In addition to the GWPs, a combination of widely accepted, peer-reviewed protocols and emission factors were used to estimate the GHG emissions, as summarized in Table 12. Table 12 Factors Used to Calculate GHG Emissions from Biogas Production and Reuse Description Units Value Source Biogas HHV BTU/scf 550 L/EWWTP Colorado Average Natural Gas HHV BTU/scf 1,060 U.S. Energy Information Administration, 2015 Biogas Combustion kg CO2/MMBtu 52.07 40 CFR 98.33 and Subpart C kg CH4/MMBtu 0.0032 kg N2O /MMBtu 0.00063 Natural Gas Combustion kg CO2/MMBtu 53.06 40 CFR 98.33 and Subpart C kg CH4/MMBtu 0.001 kg N2O /MMBtu 0.0001 DGEs BTU/DGE 129,500 NAFA Fleet Management Association, 2010 GHG emissions and offsets were evaluated for the two scenarios described above and compared against the project baseline. The project baseline of reusing biogas for heat provides an offset of 1,539 metric tons of CO2e annually. Repurposing biogas to fuel vehicles increases GHG offsets to 5,386 metric tons of CO2e annually. If the biogas is sent to pipeline injection, GHG emission offsets increase even further to 6,855 metric tons of CO2e per year. A comparison of these offsets is shown in Figure 12. Page 291 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 21 Figure 12 GHG Offsets Based on Type of Biogas Reuse 1.8 Financing and Procurement Options The L/EWWTP has multiple options to procure and finance the gas cleaning equipment and complete the design and construction of the facilities to begin generating revenue. These options need to be consistent with the L/EWWTP’s budgeting and procurement procedures. During the next phase of design development, the project team will further evaluate the financing options and develop recommendations. The various financing options include: 1. Self-Financed: The Cities of Littleton and Englewood would provide the capital improvements funds for the design and construction using wastewater rates and existing financial reserves. This type of financing provides the best financial returns and maintains maximum control; however, it is only feasible if the funds are available. 2. Financial Institutions: A bank or private equity loan could be obtained by the Cities of Littleton and Englewood to cover the capital costs and payment would be spread out over multiple years. This would reduce the immediate financial impacts and would defer payments out for a period of time which would be off-set by revenue produced. a. A subset of a private equity loan would be a tax-exempt loan, which is used by many Colorado cities and regulated by the State of Colorado. This type of loan approach has been part of the State statutes for over 40 years. Using a tax-exempt loan allows the City to leverage capital at a low cost of borrowing and each year, the loan is re- approved. If the market changes were significant, L/EWWTP could have the borrower possess the digester cleaning equipment and sell it on the open market. This is a very low cost option, which still provides high return on the investment and presents a balanced approach to economic viability risks associated with the RINs credits. 0 1,000 2,000 3,000 4,000 5,000 6,000 7,000 Biogas for Heat Biogas for Vehicle Fuel Biogas for Pipeline InjectionGHG Offsets, MT-CO2e/yearAnnual Metric Tons of Carbon Dioxide Equivalent Offsets Page 292 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 22 | SEPTEMBER 2017| REVISED DRAFT 3. Municipal Tax-Exempt Bonds: L/EWWTP and the Cities of Littleton and Englewood could elect to issue municipal bonds to fund the capital investment. This option would raise money and spread out the re-payment over a period of time. This type of funding approach was not recommend for further analysis as it takes significant time and cost to develop a bond issuance, including potential voter approval. With other existing loans and the possibility of future bond issues to cover capital expenditures, Carollo believes other options are more viable. 4. Third-Party Contracted Financing: L/EWWTP could partner with a third-party entity and establish a power purchase agreement. This agreement would cover the financing and L/EWWTP would be provided a royalty or lease payment for the duration of the contract. The third-party entity could be a private equity firm, an equipment provider, or other energy company. Typically, these types of agreements require a long-term commitment (greater than 10 years) from L/EWWTP and include performance guarantees. There is still a beneficial financial return on the investments; however, this approach will typically provide 30 to 50 percent less return than the first two options. Using a power purchase agreement also can be challenging since digester gas quantities and qualities may change as L/EWWTP explores other improvements to maximize renewable resource values. Carollo recommends that this option be further evaluated during the next phase of the project. Based on discussions with L/EWWTP staff, the most viable option for financing the project appears to be borrowing the capital cost money from a financial institution. However, this approach needs to be confirmed with management from L/EWWTP, and the Cities of Littleton and Englewood. A sensitivity analysis on the interest rates and terms has been provided below. In addition to financing options, different procurement options are also viable for this project. The procurement options which were considered for this project include: 1. Design-Bid-Build (DBB): L/EWWTP would contract with a consulting engineer who would develop the technical design documents and serve as the Owner’s representative during construction. The biogas conditioning equipment package would likely be pre- selected based on qualifications and pricing. The construction contractor would be selected based on a competitive bidding process. 2. Construction Management at Risk (CMAR): L/EWWTP would contract with a consulting engineer to complete the technical design documents and serve as the Owner’s Representative during construction. The equipment package would likely be pre-selected based on a qualifications and price based proposal. The construction manager at risk would be selected at the 60-percent design level to provide value engineering and constructability support during the design and then complete the construction. The CMAR selection could be based on qualifications and price based proposal. 3. Design-Build (DB): L/EWWTP would hold one contract with a design and construction team. This team would execute the technical design documents, equipment procurement and construction services. In addition to the DB team, L/E may choose to hire an Owner’s Advisor to assist with procurement, contract management, and technical input. Based on the project scope and intent of L/E staff for this project, an approach similar to the CMAR option above would be the best suited for this project. The CMAR approach will shorten the procurement schedule and provides time for constructability reviews and value engineering Page 293 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 23 input. These are elements are important for L/E as time to market and maintaining budget and control are critical objectives to achieving profitability quickly. 1.9 Summary and Recommendations After evaluating both economic and non-economic considerations, including capital and life cycle impacts, Carollo recommends proceeding with pipeline injection alternative. The L/EWWTP's digestion process will not change, and the existing dual fuel boilers will remain in use, fully fueled by natural gas. The gas conditioning skid is recommended to be installed to the south of the current digesters and cogeneration engine room. The pipeline routing to convey the treated gas to the northern boundary will be finalized during design. Xcel's monitoring equipment will be installed in an enclosure at the northern boundary of the plant with an internal fence and Xcel access gate from the outside. An example of the site plan is shown in Figure 13. Figure 13 Future Site Plan Page 294 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 24 | SEPTEMBER 2017| REVISED DRAFT 1.9.1 Sensitivity Analyses Carollo performed two sensitivity analyses to evaluate the possible outcomes of this project. The first was to look at the changes in RIN values and the second was an analysis of different financing options. 1.9.1.1 RIN Value Since the RIN value has the largest impact on the 20-year net present value of the alternatives, a sensitivity analysis was performed on the pipeline injection alternative to determine a reasonable bandwidth of costs over a 20-year period. The analysis assumes the current RIN value of $2.50 for the baseline case and all RIN values increase with inflation at 3 percent per year. Carollo performed a sensitivity analysis looking at RIN value scenarios shown in Table 13. Table 13 and Figure 14 present the results of this analysis. The analysis illustrates that for all likely scenarios, the pipeline injection alternative will have generated significant revenue and positive net present value for L/E. Table 13 Net Present Value at Varying RIN Values RIN Value Timeline 20-Year Net Present Value $1.78/RIN, $0/RIN 2019-2022 2023-2038 ($8,270,600) $1.78/RIN 2019-2038 $8,749,000 $2.50/RIN (baseline case) 2019-2038 $17,973,300 $3.00/RIN 2019-2038 $24,379,000 Figure 14 shows that there is no payback if RIN credits drop to $0 in 2023 due to change at EPA. If this occurs, L/EWWTP should use the exit strategy approaches listed below. Figure 14 RIN Pricing Sensitivity $(10) $(5) $- $5 $10 $15 $20 $25 $30 $35 $40 $45 0 2 4 6 8 10 12 14 16 18 20Cummulative Revenues ($ in Millions)Pipeline Injection Years in Operation Cash Flow Forecast Based on RIN Value Sensitivity Assumes No Financing, Capital Investment = $7.5M in 2018 (Year 0) $3.00/RIN $2.50/RIN $1.78/RIN $1.78/RIN thru 2022; $0/RIN after 4-year payback No Payback Use exit strategy 6-year payback3-year payback Page 295 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 25 1.9.1.2 Financing Options In order to evaluate how to finance the project, Carollo examined three different financing rates and terms (durations) to evaluate the potential ranges of financing options. Table 14 and Figure 15 illustrate the three scenarios and the results for the 20-year net present value. Based on these rates and terms, the variance in the 20-year net present value results is negligible based on all the assumptions used. Assuming L/E can manage the monthly payments, the financing terms should be less than 7 years duration and preferably the shorter the more advantageous. Table 14 Net Present Value with Varying Financing Options Interest Rate Loan Terms (duration) 20-Year Net Present Value Baseline (L/EWWTP-financed) 0 $17,973,300 3% 3-year $18,179,400 5.5% 7-year $17,621,300 8% 10-year $16,486,600 Notes: (1) RIN value = $2.50 (baseline condition). Figure 15 shows the annual cumulative cash flow projections based on the financing scenarios listed in Table 14. This figure illustrates using a financing option to procure the design and construction services for the pipeline injection alternative appear to be most prudent and generate positive cash flow for L/EWWTP before the RINs credits expire. Figure 15 Financing Sensitivity $(10) $(5) $- $5 $10 $15 $20 $25 $30 $35 $40 $45 0 2 4 6 8 10 12 14 16 18 20Cummulative Revenues ($ in Millions)Pipeline Injection Years in Operation Cash Flow Forecast Based on Financing Sensitivity Assumes RIN = $2.50; Capital Investment = $7.5M in 2018 (Year 0) No Financing Loan (3yr, 3%) Loan (7yr, 5.5%) Loan (10yr, 8%) 4-year payback Page 296 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 26 | SEPTEMBER 2017| REVISED DRAFT For 7- and 10-year loans, the L/EWWTP would have a positive cash flow starting in year one and continuing throughout the project. The 3-year loan payments would result in a negative cash flow through the third year of operation and by year five, the project would reach a net positive payback. 1.9.2 Exit Strategies As part of this evaluation, the team identified several revenue generating exit strategies that may be used in the event that the RFS Program is significantly modified beyond 2022, such that RINs no longer hold sufficient value to continue with pipeline injection. While this is not anticipated to be the case based on conversations with both RIN brokers and obligated parties (e.g., oil producers), it is prudent to identify these alternatives at the project outset. One possible off-ramp from pipeline injection may be to install a CNG fueling station either on- site or adjacent to the L/EWWTP in the future. If CNG vehicles become more common and CNG fuel prices increase, the L/EWWTP may be able to realize a revenue stream from conditioning the gas and selling it directly as vehicle fuel. The L/EWWTP location adjacent to Santa Fe Road makes this a viable future option. The capital cost for this exit strategy is anticipated to be in the range of $1 to $2 million, with a potential revenue stream of $100,000 per year. This revenue stream is highly dependent on CNG demand from the fueling station. Another possible off-ramp is to return to cogeneration to produce electricity. With the gas conditioning system already installed, the L/EWWTP has the option to re-start the existing engines or purchase new engines. With the proper gas conditioning, it is anticipated that the engines would have significantly lower maintenance as compared to plant staff’s previous experience. The capital cost for installation of two new engines is anticipated to be in the range of $2 to $3 million, with a potential revenue stream (or electricity cost offset) of $500,000 per year. 1.10 Implementation Plan In order to take advantage of the legally mandated RIN quotas through 2022, it is in the L/EWWTP’s interest to get the project on track as quickly as possible (i.e., reduce the time to market). As part of this effort, L/EWWTP staff and Carollo developed an implementation plan to forecast required activities and lead times. Figure 15 shows a general schedule, with the major required activities and coordination items spelled out. Figure 16 Implementation Schedule One critical activity that has been identified is coordination with Xcel Energy. The development and acceptance by all parties of an Interconnect Agreement between L/EWWTP and Xcel will be a critical project milestone. As such, members of the L/EWWTP staff, Carollo, and Xcel Energy met to discuss the required gas quality, Xcel required monitoring equipment, and other Page 297 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017| 27 preconditions for an agreement. The L/EWWTP and Xcel will work together to agree on a Memorandum of Understanding so the L/EWWTP has a commitment from Xcel while working on the other coordination items identified in the implementation schedule. Additional steps shown in the schedule include: • Securing financing, • Developing a request for proposals to obtain a RIN broker, • Developing a contract with the design engineer, • Performing the engineering design, • Procuring the biogas conditioning equipment, • Construction, and • RIN certification. It is the goal of the L/EWWTP to have all of the above steps completed by the end of 2018 such that RIN credits may begin to be realized in 2019. Page 298 of 319 LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT | BIOGAS USE APPLICATIONS REPORT 28 | SEPTEMBER 2017| REVISED DRAFT -This Page Intentionally Left Blank- Page 299 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017 Appendix A XCEL RNG QUALITY REQUIREMENTS Page 300 of 319 Page 301 of 319 Xcel Energy Renewable Natural Gas Quality Specifications ColoradoHazardous Substances/Objectionable Matter*Constituents/PropertiesLimitUnitsConstituents/PropertiesProposed LimitUnitsHigher Heating Value 965 - 1100Btu/scfVolatile Organic Compounds (VOCs)Wobbe (based on HHV)1185 - 1285Siloxanes (Total Si)0.1mg/m3 Carbon Dioxide (mol %)3.0mol %Vinyl Chloride1170ppbvOxygen2.0mol %Total Inerts14.3mol %BTEX and other aromatics50 ppmvWater Vapor Content 3lb/ MMscfHexanes+ Alkanes100 ppmvOther VOCs100 ppbvSemi-Volatile Organic Compounds100ppbvTemperature32 110°FPolycyclic Aromatic Hydrocarbons100ppbvVolatile Fatty Acids10ppbvPolychlorinated Biphenyls0.1ppbvPesticides1ppbvProducts1ppbvInorganic Compounds/MetalsMercury0.01g/m3Hydrogen0.1mol %Arsenic, Zinc, Antimony0.01g/m3Ammonia10ppmvBiologicals0.2 micron *Constituents may vary with type of biogasgr/Cscf (ppmv)Dust, dirt, gum and other solidsFree ofWater & hydrocarbons in liquid formFree ofppmvFormaldehyde/Aldehydes and Ketones100 ppbvPublic Service Company of Colorado Gas TariffINERT BLENDED SYSTEMDRAFT(Based on California Rule 30)Chorinated/Halogenated Hydrocarbons: Chlorobenzene, trichlorofluoromethane, etc.100ppbvHydrocarbon Dew Point, Cricondentherm 15°FOrganic Sulfur: Carbonyl sulfide, Carbon Disulfide, Dimethyl Sulfide, etc.1Hydrogen Sulfide H2S Total Sulfur0.25 (4)5.0 (85)August, 2016Gas Engineering - Gas QualityPage 1 of 1Appendix A-1Page 302 of 319 Page 303 of 319 BIOGAS USE APPLICATIONS REPORT | LITTLETON/ENGLEWOOD WASTEWATER TREATMENT PLANT REVISED DRAFT | SEPTEMBER 2017 Appendix B CAPITAL COST ESTIMATES Page 304 of 319 Page 305 of 319 DETAILED COST ESTIMATE Project: Biogas Use Applications Client: Littleton-Englewood WWTP Date :April 1, 2017 Location: Englewood, CO By :TMD Element: 03 WM with Dual Pass Reviewed:BJL SPEC. NO.DESCRIPTION QUANTITY UNIT UNIT COST SUBTOTAL TOTAL Division 02 - Site Construction 02300 Topsoil Strip & Stockpile On Site, To 500 Cy 550 CY $9.40 $5,167 Total $5,167 Division 03 - Concrete 03300 8" Flat Non-Formed S.O.G.95 CY $339 $32,214 Total $32,214 Division 11 - Equipment 11000 CNG Storage 1 EA $750,000 $750,000 11000 BioCNG Thermal Oxidizing Flare 1 EA $341,900 $341,900 11000 BioCNG 400 DP Winterization 1 EA $266,000 $266,000 11000 BioCNG 400 DP 1 EA $2,041,491 $2,041,491 11000 BioCNG Control Panel 1 EA $45,000 $45,000 Total $3,444,391 Division 15 - Mechanical 15000 Pipe Tunnelling under River 120 LF $800 $96,000 15267 4" Sdr 11 Hdpe Pipe In Open Trench 17,500 LF $54 $940,625 15286 6" Sch 40S Buttwelded 316L Sst Pipe In A Bldg To 12' Ht.200 LF $116 $23,273 Total $1,059,898 Division 16 - Electrical 16000 EI&C Allowance 15% of Div 11 $3,444,391 $516,659 Total $516,659 Division 17 - Instrumentation and Controls 17000 Contingency 20% EA $5,058,328 $1,011,666 17000 General Contractor Overhead, Profit, and Risk 15% EA $6,069,994 $910,499 17000 Escalation to Mid-Point (2018)5% EA $6,980,493 $349,025 Total Construction Cost $7,324,351 17000 Engineering, Legal, and Administrative Fees 15% EA $7,324,351 $1,098,653 Total $8,423,003 Grand Total $8,423,003 f/n: LE Capital Cost Estimate-03 WM with Dual Pass Page 2 of 2 Form Rev: 2008June Appendix B-1 Page 306 of 319 DETAILED COST ESTIMATE Project: Biogas Use Applications Client: Littleton-Englewood WWTP Date :April 2017 Location: Englewood, CO By :TMD Element: 02 Pipeline Injection Reviewed:BJL SPEC. NO.DESCRIPTION QUANTITY UNIT UNIT COST SUBTOTAL TOTAL Division 02 - Site Construction 02300 Topsoil Strip & Stockpile On Site, To 500 Cy 550 CY $9.40 $5,167 Total $5,167 Division 03 - Concrete 03300 8" Flat Non-Formed S.O.G.95 CY $339 $32,214 Total $32,214 Division 11 - Equipment 11000 BioCNG 400 DP 1 EA $2,041,491 $2,041,491 11000 BioCNG Control Panel 1 EA $45,000 $45,000 11000 BioCNG 400 DP Winterization 1 EA $266,000 $266,000 11000 BioCNG Thermal Oxidizing Flare 1 EA $341,900 $341,900 11000 Xcel Monitoring Equipment 1 EA $1,050,000 $1,050,000 Total $3,744,391 Division 15 - Mechanical 15267 4" Sdr 11 Hdpe Pipe In Open Trench 2,500 LF $54 $134,375 15286 6" Sch 40S Buttwelded 316L Sst Pipe In A Bldg To 12' Ht.200 LF $116 $23,273 Total $157,648 Division 16 - Electrical 16000 EI&C Allowance 15% % Div 11 $3,744,391 $561,658.64 Total $561,659 Division 17 - Instrumentation and Controls 17000 Contingency 20% EA $4,501,078 $900,216 17000 General Contractor Overhead, Profit, and Risk 15% EA $5,401,294 $810,194 17000 Escalation to Mid-Point (2018)5% EA $6,211,488 $310,574 Total Estimated Construction Cost $6,522,063 17000 Engineering, Legal, and Administrative Fees 15% EA $6,522,063 $978,309 Total Project Cost $7,500,372 f/n: LE Capital Cost Estimate-02 Pipeline Injection Page 1 of 2 Form Rev: 2008June Appendix B-2 Page 307 of 319 Page 308 of 319 Study identifies uses for L/E WWTP to recover and reuse digester gas Preliminary analysis: •Achieve alignment with L/E WWTP strategic vision •Identify the best use of gas resource •Analyze the potential to create revenue stream •Recommend best value solution with viable off-ramps •Review procurement options Pipeline InjectionCNG FuelingExisting Page 309 of 319 Pipeline injection approach achieves best value focused on sustainability Findings: •Capital investment = $7.5M (lowest of options) •Equipment payback (4 years) (lowest) •Solar projects payback typically > 10-12 years •GHG offsets = 5,500 metric tons of CO2 per year (highest offset) •Equivalent to emissions from 1,162 automobiles •Viable off-ramps with cleaner gas provides balanced risk (most flexibility) •Local and national support for Clean Energy programs Balanced RiskEnvironmentalFinancial Page 310 of 319 Simplicity of pipeline injection approach maximizes near-term opportunities Yale Avenue Xcel pipeline •Simplified and lower construction risk •No major offsite pipeline construction •Lower risk with 3rd party agreements Gas conditioning equipment Gas conditioning equipment Page 311 of 319 Design Services Recommendation •Design Engineering Services: o Carollo Engineers, Inc. o $380,400 •2017 Budget –L/E WWTP Professional Services o Budget:$1,496,000 Budget Expensed (8-31-17) $1,496,000 $406,175 Page 312 of 319 Project commissioning by end of 2018 uses streamlined approach Project Schedule -Council 1.Introduction to concept and project (Oct-16) 2.Approval to issue RFP for project (Dec-16) 3.Draft report issued by Carollo (July-17) 4.Briefing to individual Study Sessions (July-17) 5.Review at Joint Study Sessions (Aug-17) 6.Review at individual Study Sessions (Sept –17) Next Steps -Council 7.October 16, 2017 –Approval of design contract 8.January 2018 –Xcel memorandum of understanding 9.January 2018 –RIN broker services 10.Q1 2018 –City Council project update (additional financing discussions) 11.Q2 2018 –City Council approval of construction contract 12.Q4 2018 –Commissioning Page 313 of 319 Questions?Page 314 of 319 LITTLETON/ENGLEWOODWASTEWATERTREATMENTPLANT‘*3’0/CW°fLnttletonEnglewood(308)7612630FAX762»2S2?MINUTESSUPERVISORYCOMMITTEEMEETINGSeptember28,20178:30amATTENDING:SupervisogCommittee:ErieKeckEnglewoodCityManagerMarkRelphLittletonCityManagerDaveHendersonEnglewoodPublicWorksDirectorKeithReesterActingLittletonPublicWorksDirectorL/EWWTPandCityStaff:AlisonMcKenneyBrownEnglewoodCityAttorneyMattMontgomeryHill&Robbins,L/EWWTPAttorneyTomBrennanEnglewoodUtilitiesDirectorJohnKuosmanL/EWWTPDirectorBlairCorningL/EWWTPDeputyDirectorofStrategicProgramsJeniferDoaneL/EWWTPDeputyDirectorofBusinessAdministration&CommunicationsKurtCarsonL/EWWTPDeputyDirectorofOperations&MaintenanceSolutionsBrendaVamerL/EWWTPGovernmentRelationsSpecialistChongWooL/EWWTPCapitalProject&AssetLeadershipManagerDerikCaudillL/EWWTPBeyondComplianceProgramsManagerJimTallentL/EWWTPStrategicWorkforceAdvisorKacieAllardL/EWWTPCommunications&DataSupervisorGUESTS:CynthiaLanePlatteCanyonWater&SanitationDistrict,AssistantManagerI.IntroductionJohnKuosman,Littleton/EnglewoodWastewaterTreatmentPlant(L/EWWTP)Director,initiatedtheSeptemberSupervisoryCommittee(Committee)meeting.AugustCommitteemeetingminuteswereapprovedviaemailonAugust30,2017.II.Branding,NameandLogoJohnKuosmanupdatedtheCommitteeontheL/EWWTPrebrandingefforts.TheL/EWWTPstaffnotedthatchangesweremadetothenameandlogobasedonfeedbackfromJointStudySessionandPage 315 of 319 MINUTESSUPERVISORYCOMIVHTTEENEIETINGSeptember28,2017Page20|‘5L/EWWTPstaff.JeniferDoanereviewedthepresentationoutliningtheseproposedchanges.TheL/EWWTPstaffbroughtthereceivedfeedbacktotheLIEWWTPRebrandingAmbassadors,completedadditionalsurveys,andreachedouttomorestakeholders.Theresultsshowedaneedforanidenti?erattheendofthename,anhistoricalcomponent,andacompromisewiththepastandfuture.L/EWWTPstaffaskedtheCommitteeforitsfeedbackonthenewrecommendationsfortl1enameandlogo.MarkRelphandEricKeckdiscussedthesuggestionstheyheardfrombothcities’CouncilswiththeL/EWWTPstaff.TheCommitteediscussedthetimelinefortherebrandingrollout.TheCommitteerecommendedtheLIEWWTPstaffcomposeamemototheCityManagersfortheirdistributiontoCouncils,whichwillexplainhowstaffarrivedatthesenewideasandtheimplementationtimeline.III.StrategicOgeratingPlan(SOP[JohnKuosmansummarizedpastdiscussionsregardingtheStrategicOperatingPlan(SOP)withbothCouncilsattheJointCouncilStudySessioninAugustandtwoindividualStudySessionsearlierthisweek.JohnaskedtheCommitteeforitsapprovaltotaketheengineeringcontractforwardtotheCityofEnglewoodCouncilforapprovalonOctober16,2017.MarkRelphgavekudostoChangWooandJohnKuosmanforpresentingtotheLittletonCityCouncilonTuesday,September26,2017.EricKeckreiteratedMark’scommentsandnotedhoweasyitwastofollowthepresentationtotheEnglewoodCityCouncilonMonday,September25,2017.ACTIONTAKEN—TheSupervisoryCommitteeapprovedI/EWWTP’srecommendationtomoveforwardwithacontractwithCarolloEngineers,Inc.,fortheStrategicOperatingPlan(SOP),intheamountof$500,000.00.MarkRelphmoved,EricKeckseconded,allayes,nonays.TheL/EWWTPstajfwillpresenttheSOPtotheEnglewoodCityCouncilforconsiderationonOctober16,2017.IV.BioastoRenewableNaturalGasGPro'ectJohnKuosmansummarizedpastdiscussionsregardingtheBiogastoRenewableNaturalGas(RNG)ProjectwithbothCouncilsincludingtwoindividualStudySessionsinJuly,theJointCouncilStudySessioninAugust,andtwoindividualStudySessionsearlierthisweek.JohnaskedtheCommitteeforitsapprovaltotaketheengineeringcontractforwardtotheCityofEnglewoodCouncilforapprovalonOctober16,2017.ACTIONTAKEN-TheSupervisoryCommitteeapprovedIJEWWTP’:recommendationtomoveforwardwithaprofessionalservicesagreementwithCarolloEngineers,Inc.,fortheBiogastoRenewableNaturalGas(RNG)Project,intheamountof$380,400.00.MarkRelphmoved,EricKeckseconded,allayes,nohays.TheUEWWTPstaffwillpresenttheBiogastoRenewableNaturalGas(RNG)ProjecttotheEnglewoodCityCouncilforconsiderationonOctober16,2017.Page 316 of 319 MWUTESSUPERVISORYCOMMITTEEIVEEETINGSeptember28,2017Page3V.VI.VII.VIII.ot'5Kiowa/BennettPropergDispositionJohnKuosmansummarizedthekeydiscussionpointsoftheKiowa/BennettPropertyDispositionPresentationfromtheAugustJointCouncilStudySession.JohnaskedeachCommitteememberifheorshehadreceivedanyfurtherfeedbackfromtheCouncils.BothEricKeckandMarkRelphbelievedthattheCouncilswouldliketoholdontotl1epropertyandtosellatalaterdate.TheCommitteerecommendedthatL/EWWTPstaffcontinuethecurrentleasingstructure,holdontotheproperty,andnotactivelyseeksolarorwindleasing.TheCommitteealsorequestedthatL/EWWTPstaffcomposeasummarydocumentfortheCityManagerstodistributetotheCouncils.2018L/EWWTPFiscalYearBudgetJohnKuosmansubmittedabudgetexplanationmemotoeachCityManagerinJuly2017,ontheproposed2018L/EWWTPBudget.JohnclarifiedthattheCityofEnglewoodelectedtoleaveitsportionoftheBiogastoRenewableNaturalGas(RNG)Projectinthe2018L/EWWTPBudget;andtheCityofLittletonelectedtoremovethebudgetcostforitsportionoftheproject.MarkRelphandEricKeckconfirmed.ACTIONTAKEN-—TheSupervisoryCommitteerecommendedthe2018UEWWTPBudgetbebroughtforwardtotheEnglcwoodCityCouncilforapproval.EricKeckmoved,MarkRelphseconded,allayes,nonays.The2018L/EWWTPBudgetwillbepresentedtotheEnglewoodCityCouncilforconsiderationonfirstreadingonOctober2,2017,andforconsiderationforsecondreadingonOctober16,2017.ValmetAnalyzerPurchaseJohnKuosmanupdatedtheCommitteeabouttheLIEWWTPstaffsworktoimprovethedewateringprocess.Thepurchaseofanewinstrument,theValmetAnalyzer,willallowforoptimalpolymerdosinginL/EWWTP’sdewateringprocess.ThisnewinstrumentshouldsavetheL/EWWTPapproximately$57,750inpolymercostsannually.BlairCorningdiscussedhowthisprojectisagreatdealandveryimportanttoL/EWWTPstaff.Thesavingsthatcanberealizedandthepay-backperiodofoneyeararebene?cialtodieorganization.Mostimportantly,thisprojectspeakstowardsL/EWWTP’scommitmenttoinnovation.2018ColoradoStateUniversiCSBiosolidsResearchProosalJohnKuosmanreviewedhisdecisiontorenewtheintergovernmentalagreement(IGA)betweenL/EWWTPandCSUtostudyBiosolidsapplication.Pursuanttoordinance,theLIEWWTPDirectorcanrenewtheIGA.Page 317 of 319 MINUTESSUPERVISORYCOMNHTTEEMEETDVGSeptember28,2017Page4of5BlairCorningdescribedCSU’sproposedstudiesfor2018.CSUwillcontinueongoingstudiesofthemeasurementofPhosphorus(P)insoil.Thisyear,CSUwillbeginusingamodelingtooltoquantifyPinthesoilanditslong-termimpacttothesoil.ThesestudieswillbeusedbytheEnvironmentalProtectionAgency(EPA)andmanyresourceinstitutionsforreliableresearchdata.Thisyear’stotalcostis$122,000;lastyear’stotalcostwas$117,000.D(.DiscussionoflnformationnlItems:UpdateonDigesterRoofProject:EricKeckaskedforanupdateontheDigesterRoofProject.ChongWoodiscussedthestatusofthisprojectwiththeCommittee.AsummaryofthestatusofthisprojectwillbeaddedintothesummaryupdateforbothCityCouncilsfortheOctobermeeting.ReguiredReporting:JohnKuosmandiscussedthein?uent?owandloadsummaryforthemonthofAugust2017.Themeasured?owtotheL/EWWTPaveraged21.1mgdinAugust2017,whichwasanincreaseof0.2fromJuly2017.Themeasured?owsplitbetweentheCitiesofLittletonandEnglewoodrespectivelywas42.2/57.8percent.FutureJointCouncilStudySessionRecommendation:JohnKuosmandiscussedanalternativeapproachtotheJointCouncilStudySessions.AccordingtotheJointUseAgreement,L/EWWTPisrequiredtoholdonejointmeetingperyearwithbothCouncils.JohnoutlinedthepossibilityofutilizingindividualCityCouncilStudySessionswitheachCouncilinadditiontotheannualmeeting.TheCommitteediscussedthisalternateapproachandthetimingofthearuiualmeeting.MarkRelphsuggestedusingthemonthofJulyfortheannualmeetingtoassistwiththebudgetingprocess.TheL/EWWTPstaffwillcompileaproposedschedulefortheCommittee’sreviewbeforesubmittingtotheCouncils.EnergyInitiatives:EricKeckrequestedasummaryofwastewatertreatmentplantenergy-savinginitiativesthatareunderwayattheL/EWWTP.JohnKuosmancon?nnedthatoneoftheinitiativesoftheL/EWWTPistogettoenergyneutrality.TheL/EWWTPhasanenergymanagementcommitteethatwillbeabletocompileasummaryforEricfor2018.UpdateonRegplatogCompliance:MattMontgomeryprovidedtheCommitteewithanupdateontheworkheandDanDeLaughterhavebeendoingwiththeWaterQualityControlDivision(Division)andotherwastewaterentitiestodeveloparegulatoryframeworkthatcouldpotentiallydefraycostsforcomplyingwithnutrientcriteriaforRegulation31.ThisproposalisanincentiveprogramthatwouldallowentitieswhomeetthePage 318 of 319 MINUTESSUPERVISORYCOMMITTEEMEETINGSeptember28,2017Page5of5nutrienttreatmentgoalsofRegulation85beforemandatorydeadlinestoaccrueadditionaltimetomeettheRegulation31nutrientgoals.ThegroupworkingonthisproposalplanstomeetonOctober2,2017,beforetheOctober9,2017hearing.Ifthisproposaloranotherincentiveprogramisapproved,thismayallowL/EWWTPtoaccrueadditionaltimetomeetcertainRegulation31nutrientrequirements.TheL/EWWTPStrategicOperatingPlan(SOP)includesthisanalysisaspartofindividualprojectbusinesscases.X.AdjournmentThenextSupervisoryCommitteemeetingisscheduledforThursday,October19,2017.Thismeetingwillbeheldfrom8:30am~10:00am,attheLittleton/EnglewoodWastewaterTreatmentPlant.Adjournedat10:13amRecordingSecretarySignatureBaJ.VarnerTheL/EWWTPSupervimryCommitteeapproved(IreSeptember28,2017meetingminutes‘viaemailonMonday,October2,2017.EricKeck,MarkRelplt,DaveHenderson,andKeithReesterallayes,nonays,minutesapproved.Page 319 of 319